Conserved Protein Domain Family
SbcD_rel_arch

?
TIGR00024: SbcD_rel_arch 
putative phosphoesterase, SbcD/Mre11-related
Members of this uncharacterized family share a motif approximating DXH(X25)GDXXD(X25)GNHD as found in several phosphoesterases, including the nucleases SbcD and Mre11. SbcD is a subunit of the SbcCD nuclease of E. coli that can cleave DNA hairpins to unblock stalled DNA replication. All members of this family are archaeal. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 129135
View PSSM: TIGR00024
Aligned: 4 rows
Threshold Bit Score: 253.24
Threshold Setting Gi: 11498793
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495754     7 IKDFYITVDRCLVYKDYAIIADTHIGFDVFFGEGGANFPLLQKDEVIKRTLNIIDKYKINNLIINGDIKHNFKPy-pKEI 85
gi 499179865   6 LMDDLEICDLSLIIEDSMVIADLHLGYEQYLNTQGVMVPGFQFRRIIERIDAIRDVSGASGIIINGDLKHEFGR---VSW 82
gi 499181112   1 MEDVLLTPERAAIVGNTAVIADLHLGFENVLQERGYAVPRMQVEEIKARVASIVEKYGIAKIVVAGDLKHEFSKnlpYEW 80
gi 499181149   1 ----MRIEEDVLFIGRKAVIADIHLGLVRHYDN-----------ELIEKALSIAER--VEALIVAGDLKHIGKKg--LHE 61
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495754    86 KFLKE------FIEFLREyiNVILIKGNHDTFISS----AGYEIFDYFELGNYLIFHGDKeiKIdrDLLKEKFWILGHEH 155
gi 499179865  83 QENREiirmmqYLEENFR--DITIIRGNHDALIPYmsqvSHLSVTETLKISCFLLAHGHV--VP--EDLDAETIIIGHEH 156
gi 499181112  81 EDVRE------FIESVNV--ELEVVRGNHDNYLAAilaeYGIELKESVRVGDYLVVHGH-------KDCEEEKVIMGHEH 145
gi 499181149  62 RFIRE------IGEVT----DLILIRGNHD---------IGLSGEKSIRIGKYGIFHGHA--VPdeEVLDAKVLIFGHAH 120
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495754   156 PSIKLRDDVgAILKFPTYLLN----KNYIVLPAFNPLSPGNDLINNSASSKIIKKS-YLEAEVIAITDIGLLNFGTLRDL 230
gi 499179865 157 PCVGLRSGE-RVEKIKCFLLGpfrdMKLLVMPSFNFVTEGSDILHEDILSPFLRESeLTEFLVYGVEDFEIFEFGTVGDL 235
gi 499181112 146 PAVKVRVRG-ALYTFPCYLVAd---GAKIVLPAFSPLMSGSDVLQGNFLSPILQKA--RKIEVYAIEE-EVVYLGSIEDL 218
gi 499181149 121 PAYFVKDSA-GGYRERVFLTGevedKRVVVLPAFNDLCASTAVNLDRPAGFMFR----R--YDYKRWY-AIMLDGTLLRI 192

                 ...
gi 2495754   231 REF 233
gi 499179865 236 LKF 238
gi 499181112 219 RKI 221
gi 499181149 193 F-- 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap