1QR7,1HFB


Conserved Protein Domain Family
aroFGH

?
TIGR00034: aroFGH 
Click on image for an interactive view with Cn3D
phospho-2-dehydro-3-deoxyheptonate aldolase
[Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 129145
View PSSM: TIGR00034
Aligned: 9 rows
Threshold Bit Score: 614.429
Threshold Setting Gi: 144965
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QR7_A         6 DDLRIKEI-KE--LLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPVAAKEYATRLLALREE 82
gi 447090781   4 DALNNVHItDEqvLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETALEYARRFKALAAE 83
gi 499171655  13 DDTRIEKV-DQ--VLPPIALLEKYPASEQAAALVKQTRHEAHNIIHGKDDRLLVVIGPCSIHDPKAAIEYATRLKPLREK 89
gi 145378      5 DELRTARI-ES--LVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAMEYATRLQSLRNQ 81
gi 868026      5 DELRTIRI-DP--LITPSELAKKYAITSEIMDNVIITRQNIARIMTGEDLRLLVVIGPCSVHDPIAAVEYAHRLYELRKK 81
gi 398365167  15 EDWRIKGY-DP--LTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHDPKAAYDYADRLAKISEK 91
1HFB_A        21 EDVRILGY-DP--LASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHDLEAAQEYALRLKKLSDE 97
gi 153880      4 DALNNVRItDEqvLMTPEQLKAAFPLSLAQEAQIAQSRGIISDIIAGRDPRLLVVCGPCSIHDPETALEYARRFKALAAE 83
gi 144965     14 SNKRVVAF-HE--LPSPTDLIAANPLTPKQASKVEQDRQDIADIFAGDDDRLVVVVGPCSVHDPEAAIDYANRLAPLAKR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QR7_A        83 LKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAI 162
gi 447090781  84 VSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAI 163
gi 499171655  90 YKDSLEIIMRVYFEKPRTTVGWKGLINEPYLNDTYRLNDGLRIARKLLSDINDLGVPAAGEFLDMITPQYLADFMSWGAI 169
gi 145378     82 YQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARKLLLQVNELGVPTATEFLDMVTGQFIADLISWGAI 161
gi 868026     82 YQDRLEIIMRTYFEKPRTVVGWKGLISDPDLNGSFRVNHGLAVARKLLLDINELGCLQQQSFLDMVIGQFIADLISWGAI 161
gi 398365167  92 LSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRISREMFIKLVEK-LPIAGEMLDTISPQFLSDCFSLGAI 170
1HFB_A        98 LKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQSARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAI 177
gi 153880     84 VSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLKIARQLLVELVNMGLPLATEALDPNSPQYLGDLFSWSAI 163
gi 144965     91 LDQDLKIVMRVYFEKPRTTVGWKGLINDPHLNETYDIPEGLRIARKVLIDVVNLDLPVGCEFLEPNSPQYYADTVAWGAI 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QR7_A       163 GARTTESQVH-RELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKE-PN 240
gi 447090781 164 GARTTESQTH-REMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKA-PN 241
gi 499171655 170 GARTTESQVH-RELASGLSCAVGFKNATNGGVKVALDAIGAAEAPHYFLSVTKFGHSAIVSTKGNEDCHIILRGGDKgPN 248
gi 145378    162 GARTTESQIH-REMASALSCPVGFKNGTDGNTRIAVDAIRAARASHMFLSPDKNGQMTIYQTSGNPYGHIIMRGGKK-PN 239
gi 868026    162 GARTTESQIH-REMASALSCPVGFKNGTDGNIRIAIDAIRAAQARHLFFAPNKDGQMTINHTSGNPYGHIIMRGGRT-PN 239
gi 398365167 171 GARTTESQLH-RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLILRGGKNgTN 249
1HFB_A       178 GARTTESQLH-RELASGLSFPVGFKNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKgTN 256
gi 153880    164 GARTTESQTH-REMASGLSMPVAFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPHGHVILRGGKA-PN 241
gi 144965    171 GARTTESQVHrRQLASGMSMPIGFKNGTDGNIQVAVDAVQAAQNPHFFFGTSDDGALSVVETAGNSNSHIILRGGTSgPN 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QR7_A       241 YSAKHVAEVKEGLNKAGLPA----QVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVESHLVEGNQSLe--- 313
gi 447090781 242 YSPADVAQCEKEMEQAGLRP----SLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSS---- 313
gi 499171655 249 YSAEDVEKVCADIEKTGRIP----HVMVDFSHANSSKQYKKQMDVCQDVCNQIAFGSKQIFGVMVESHLVEGRQDLv--- 321
gi 145378    240 YHADDIAAACDTLHEFDLPE----HLVVDFSHGNCQKQHRRQLEVCEDICQQIRNGSTAIAGIMAESFLREGTQKIv--- 312
gi 868026    240 YHAHDINSAIEHLREFNLLE----HLMIDFSHGNCLKEHIRQKDVAKSVSKQISQGSKTIFGVMIESFLEEGFQTVk--- 312
gi 398365167 250 FDKESVQNTKKQLEKAGLTDdsqkRIMIDCSHGNSNKDFKNQPKVAKCIYDQLTEGENSLCGVMIESNINEGRQDIpke- 328
1HFB_A       257 YDAKSVAEAKAQLPAGSNG------LMIDYSHGNSNKDFRNQPKVNDVVCEQIANGENAITGVMIESNINEGNQGIpa-- 328
gi 153880    242 YSPADVAQCEKEMEQAGLRP----SLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSS---- 313
gi 144965    251 HDAASVEAV---VEKLGENA----RLMIDASHANSGKDHIRQVEVVREIAEQISGGSEAVAGIMIESFLVGGAQNLdpak 323
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|...
1QR7_A       314 ----sGEP---LAYGKSITDACIGWEDTDALLRQLANAVKARR 349
gi 447090781 314 -----EQPrseMKYGVSVTDACISWEMTDALLREIHQDLNGQL 351
gi 499171655 322 ----dGKA---QTYGQSITDACIGWEDSERLLQQLSDAVIARR 357
gi 145378    313 ----gSQP---LTYGQSITDPCLGWEDSERLVEKLASAVDTRF 348
gi 868026    313 ----eNQP---LIYGKSITDACLNWKDSVLIIKQLADAVDTRF 348
gi 398365167 329 ---ggREG---LKYGCSVTDACIGWESTEQVLELLAEGVRNRR 365
1HFB_A       329 ---egKAG---LKYGVSITDACIGWETTEDVLRKLAAAVRQRR 365
gi 153880    314 -----EQPrseMKYGVSVTDACISWEMTDALLREIHKDLSGQL 351
gi 144965    324 lringGEG---LVYGQSVTDKCIDIDTTIDLLAELATAVRERR 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap