1UEH,2D2R


Conserved Protein Domain Family
uppS

?
TIGR00055: uppS 
Click on image for an interactive view with Cn3D
undecaprenyl diphosphate synthase
This enzyme builds undecaprenyl diphosphate, a molecule that in bacteria is used a carrier in synthesizing cell wall components. Alternate name: undecaprenyl pyrophosphate synthetase. Activity has been demonstrated experimentally for members of this family from Micrococcus luteus, E. coli, Haemophilus influenzae, and Streptococcus pneumoniae. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129165
View PSSM: TIGR00055
Aligned: 9 rows
Threshold Bit Score: 319.349
Threshold Setting Gi: 465535
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UEH_A      19 RHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALD---- 94
gi 6175088  19 RHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALD---- 94
gi 1175330  11 KHVAIIMDGNGRWAKQKNKMRIFGHTNGVTAVRKAVAYARQIGVEVLTLYAFSSENWSRPEQEISALMSLFMQALD---- 86
gi 2501569  50 khvaiiMDGNRRAAEIYGKDRYYGHYLGAEKVREVLRWARDLGINVVTLYAFSTENFRRPKEEVDKLMELFEKKFYeiad 129
gi 2501567   6 KHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRPKSEVDFLMKMLKKYLK---- 81
gi 465535   33 RHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMSRILELCYEAGVDTATVFAFSIENFKRSSREVESLMTLARERIRqite 112
gi 2501568  22 QHVAVIMDGNGRWAKQRGMPRIMGHQRGVDSLKNLLRCCDDWGIAALTAYAFSTENWGRPLEEVEFLMTLFERVLR---- 97
gi 2501565  68 EHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDefak 147
2D2R_A      17 KHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRPKSEVDFLMKMLKKYLK---- 92
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UEH_A      95 SEVKSLHR-HNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQID 173
gi 6175088  95 SEVKSLHR-HNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQID 173
gi 1175330  87 REVKKLHK-NNICLKIIGDVSRFSETLQEKIKKAENLTEKNTALTLNIAANYGGCWDIIQAAKQIAEKVKKEEMSVSDIN 165
gi 2501569 130 DE--EIHR-YEVRVRAIGRINLLPKNVQKAIKYAEERTKNYNKFFVNIAIAYGGQQEIIDAVKKIAEKVKRGEIEPEDID 206
gi 2501567  82 DERSTYLN-NNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLLESPPSHINLLESLE 160
gi 465535  113 RGELAC-K-YGVRIKIIGDLSLLDKSLLEDVRVAVETTKNNKRATLNICFPYTGREEILHAMKETIVQHKKGAA----ID 186
gi 2501568  98 RELKEMMA-ENVRIRFVGNLTSLPRSLQDEIARSMEDTKNNTGIRFTVATNYGGRQEIVHVCQAIAREVQSGKLDPETID 176
gi 2501565 148 RAKDYKDPlYGSKIRIVGDQSLLSPEMRKKIKKVEEITQDGDDFTLFICFPYTSRNDMLHTIRDSVEDHLENKSPRINIR 227
2D2R_A      93 DERSTYLD-NNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLLESPPSNISLLESLE 171
                      170       180       190       200       210       220       230
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
1UEH_A     174 EEMLNQHVCmHELA-P-VDLVIRTGGEHRISNFLLWQIAY-AE-LYFTDVLWPDFDEQDFEGALNAFANrERRFG 244
gi 6175088 174 EEMLNQHVCmHELA-P-VDLVIRTGGEHRISNFLLWQIAY-AE-LYFTDVLWPDFDEQDFEGALNAFANrERRFG 244
gi 1175330 166 NSTFQHHLAtQNAP-P-VDLLIRTSGEQRISNFLLWQIAY-AE-LYFSDVLWPDFNQLEFNRAIASYQQrHRRFG 236
gi 2501569 207 KELIDKHLYtANLPfPnPDLIIRTSGEERISNFLIWQSSY-SE-LYFCDIYWPLFRRVDFLRAVRDYQRrQRRFG 279
gi 2501567 161 NEISNRLDT-HDLP-E-VDLLLRTGGEMRLSNFLLWQSSY-AE-LFFTPILWPDFTPKDLENIISDFYKrVRKFG 230
gi 465535  187 ESTLESHLYtAGVP-P-LDLLIRTSGVSRLSDFLIWQASSkGVrIELLDCLWPEFGPIRMAWILLKFSF-HKSFL 258
gi 2501568 177 EGVVEKYLYtEGLS-H-PDLLIRTSGELRISNFLLWQMAY-AE-IYVTSTLWPDFDRQAFHLALRDYQQrHRRFG 247
gi 2501565 228 KFTNKMYMG-FHSN-K-CELLIRTSGHRRLSDYMLWQVHEnAT-IEFSDTLWPNFSFFAMYLMILKWSF-FSTIQ 297
2D2R_A     172 NEISNRLDt-RNLP-E-VDLLLRTGGEMRLSNFLLWQSSY-AE-LFFTPILWPDFTPKDLENIISDFYKrVRKFG 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap