1GTP


Conserved Protein Domain Family
folE

?
TIGR00063: folE 
Click on image for an interactive view with Cn3D
GTP cyclohydrolase I
alternate names: Punch (Drosophila),GTP cyclohydrolase I (EC 3.5.4.16) catalyzes the biosynthesis of formic acid and dihydroneopterin triphosphate from GTP. This reaction is the first step in the biosynthesis of tetrahydrofolate in prokaryotes, of tetrahydrobiopterin in vertebrates, and of pteridine-containing pigments in insects. [Biosynthesis of cofactors, prosthetic groups, and carriers, Folic acid]
Statistics
?
PSSM-Id: 129173
View PSSM: TIGR00063
Aligned: 7 rows
Threshold Bit Score: 297.824
Threshold Setting Gi: 170767486
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GTP_A        39 IAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVdEIFSGLDYANF-PKITLIENKMKVDEMVTVRDITLTSTCEHHFVTI 117
gi 2494696    50 MMDAVRVMLESVGEDPEREGLLKTPKRVAEAMQ-FLTQGYDQSLE-KLVNGAIFDEGHNEMVLVRDIDFFSLCEHHMLPF 127
gi 1730247    61 ISGAIKTILTELGEDVNREGLLDTPQRYAKAML-YFTKGYQTNIMdDVIKNAVFEEDHDEMVIVRDIEIYSLCEHHLVPF 139
gi 127481      9 IEQAVRQILEAIGEDPNREGLLDTPKRVAKMYA-EVFSGLNE-DP-KEHFQTIFGENHEELVLVKDIAFHSMCEHHLVPF 85
gi 3023869     1 MENFFNQFFESIGEDKNREGLKETPKRVQELWK-FLYKGYKEDPR-VALKSAYFQGVCDEMIVAQNIEFYSTCEHHLLPF 78
gi 606997305  40 IAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVdEIFSGLDYANF-PKITLIENKMKVDEMVTVRDITLTSTCEHHFVTI 118
gi 1169876    38 IAKHMHEVMKLIGLDLRDDSLEETPNRLAKMFIdEIFSGMDYANF-PKMTKIKNQMKVSEMVQVNDITLTSTCEHHFVTI 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GTP_A       118 DGKATVAYIPKD-SVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTT 196
gi 2494696   128 MGKAHLAYIPNQ-KVVGLSKLARIVEMFSRRLQVQERLTRQIAEAVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVT 206
gi 1730247   140 FGKVHIGYIPNK-KVIGLSKLARLAEMYARRLQVQERLTKQIAMALSDILKPLGVAVVMEASHMCMVSRGIQKTGSSTVT 218
gi 127481     86 YGKAHVAYIPRGgKVTGLSKLARAVEAVAKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVT 165
gi 3023869    79 LGNISVGYIPKE-KIVGISAIAKLIEIYSRRLQIQERLTIQIAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKT 157
gi 606997305 119 DGKATVAYIPKD-SVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTT 197
gi 1169876   117 DGKVCVAYYPKD-WVIGLSKINRIVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVT 195
                        170       180
                 ....*....|....*....|...
1GTP_A       197 TSLGGLFKSSQNTRHEFLRAVRH 219
gi 2494696   207 SAMIGSFQNEQKTREEFLNLIRH 229
gi 1730247   219 SCMLGGFRAH-KTREEFLTLLGR 240
gi 127481    166 SAVRGVFKDDAAARAEVLEHIKR 188
gi 3023869   158 SVLRGLFKKDSKTRAEFMQLLKS 180
gi 606997305 198 TSLGGLFKSSQNTRHEFLRAVRH 220
gi 1169876   196 SAYGGVFLEDRDTRKEFLATVQK 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap