2E0W


Conserved Protein Domain Family
g_glut_trans

?
TIGR00066: g_glut_trans 
Click on image for an interactive view with Cn3D
gamma-glutamyltranspeptidase
Also called gamma-glutamyltranspeptidase (ggt). Some members of this family have antibiotic synthesis or resistance activities. In the case of a cephalosporin acylase from Pseudomonas sp., the enzyme was shown to retain some gamma-glutamyltranspeptidase activity. Other, more distantly related proteins have ggt-related activities and score below the trusted cutoff. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 129176
View PSSM: TIGR00066
Aligned: 7 rows
Threshold Bit Score: 694.976
Threshold Setting Gi: 596034
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2E0W_A        25 GMVASVDATAT---------QVGVDILKE-GGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRS-KNGNTTAIDFREMA 93
gi 121147     49 GMVASVDATAT---------QVGVDILKE-GGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRS-KNGNTTAIDFREMA 117
gi 1707899    47 GMVATAHPLAS---------EIGADVLKK-GGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDgKTKDTTIIDSRERA 116
gi 2494731     7 GVVAAGHAQTA---------EAGKCMLEE-GGNAFDAAIASVLAACVVESSLTSLGGGGFLLAQT-AAKKSYLFDFFCQT 75
gi 447177215  38 GLALSSHPLAS---------EIGQKVLEE-GGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHL-ANGENVALDFREKA 106
gi 596034    101 LLKVGLHGAISsdlevcsnlTINEVLLKFpGSNAADAAVTQALCKGMVNFFNSGIGGGGYVVFSGkDDEDHLSIDFREKA 180
gi 489320514  10 QMVVSPHYLAS---------QAGNRILDK-GGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHqETKAVKVYNGSGRS 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2E0W_A        94 PAKATRDMFLDDQGNPDSKksl-----tsHLASGTPGTVAGFSLALDKYG--TMPLNKVVQPAFKLARDGFIVNDALADD 166
gi 121147    118 PAKATRDMFLDDQGNPDSKksl-----tsHLASGTPGTVAGFSLALDKYG--TMPLNKVVQPAFKLARDGFIVNDALADD 190
gi 1707899   117 PAGATPDMFLDENGKAIPFser----vtkGTAVGVPGTLKGLEEALDKWG--TRSMKQLITPSIKLAEKGFPIDSVLAEA 190
gi 2494731    76 PQVNPGEKAVDFYPVALNFggawqtfhigKGAIAVPGMVAGLFAAHRKLG--QLPFKVLIEPAVAYARQGFTLN-RFNDF 152
gi 447177215 107 PLKATKNMFLDKQGNVVPKlse-----dgYLAAGVPGTVAGMEAMLKKYG--TKKLSQLIDPAIKLAENGYAISQRQAET 179
gi 596034    181 PMDSHKFMFENCSLCSKIG----------GLAVGVPGELMGLYRLFKERGsgQVDWRDLIEPVAKLGSVGWQIGEALGAT 250
gi 489320514  80 GKNVTRDVYKGKSAIPLRGi---------DSAITVPGMVDSWDAVLKEYG--RLSLADVLEPARDYAQNGFPVSADQCRH 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2E0W_A       167 LKTYGSEVLPNHENSKAIFWKEGE-PLKKGDTLVQANLAKSLEMIAENG-PDEFYKGT--IAEQIAQEMQKNGGLITKED 242
gi 121147    191 LKTYGSEVLPNHENSKAIFWKEGE-PLKKGDTLVQANLAKSLEMIAENG-PDEFYKGT--IAEQIAQEMQKNGGLITKED 266
gi 1707899   191 ISDYQEKLSRTA--AKDVFLPNGE-PLKEGDTLIQKDLAKTFKLIRSKG-TDAFYKGK--FAKTLSDTVQDFGGSMTEKD 264
gi 2494731   153 TNGLLEPILTQQEEGRKFYAPQGK-ILRQGEKAYLPQFADVLEQLARHG-PDWFYRGE--LTEWVLESLGEAS-ALTAKD 227
gi 447177215 180 LKEARERFLKYS-SSKKYFFKKGHlDYQEGDLFVQKDLAKTLNQIKTLG-AKGFYQGQ--VAELIEKDMKKNGGIITKED 255
gi 596034    251 LELYEDVFLTLKEDWSFVLNSTHDgVLKEGDWIKRPALSNMLMELAKNGsVAPFYDPDhwIAKSMIDTVAKYNGIMNLQD 330
gi 489320514 149 TEKNIELLASTP-YTADIFTRRGKaPV-PGERFVQKELADSLNLIAEKG-RSAFYEGD--LAQRIVSHLQNNGSYMTIDD 223
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2E0W_A       243 LAAYKAVERTPISGDYRG--------YQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRS 314
gi 121147    267 LAAYKAVERTPISGDYRG--------YQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRS 338
gi 1707899   265 LENYDITIDEPIWGDYQG--------YQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRA 336
gi 2494731   228 WADYQVEIRLPLRAQYRQ--------RQLLTNPPPSAGGILIAFALQLLEKYDLSQYPLGSAAQIQLFSQVMALSNQARR 299
gi 447177215 256 LASYNVKWRKPVVGSYRG--------YKIISMSPPSSGGTHLIQILNVMENADLSALGYGASKNIHIAAEAMRQAYADRS 327
gi 596034    331 VSSYDVHVTKPLSMKIRKganfipdnDMTVLTSSGSSSGAALLAALRIMDNFQNQEGGDYEKETTYHLLESMKWMASARS 410
gi 489320514 224 FKAHRGEWAAPVSSDYRG--------YSVYQAPP-NSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRD 294
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2E0W_A       315 EYL-GDPDFVKVPWQALTNKAYAKSIADQIDINKAK--PSS----EIRPG------KLAPYE--SNQATHYSVVDKDGNA 379
gi 121147    339 EYL-GDPDFVKVPWQALTNKAYAKSIADQIDINKAK--PSS----EIRPG------KLAPYE--SNQTTHYSVVDKDGNA 403
gi 1707899   337 SYA-GDPEFVNVPLKGLLHPDYIKERQQLINLDQVNkkPKAgdpwKYQEGsanykqVEQPKDkvEGQTTHFTVADRWGNV 415
gi 2494731   300 QYLdGNLHCGDIEAKFLGGDRLASELGQSKFINKLG------------------------------STTHISVLDGEGNA 349
gi 447177215 328 VYM-GDADFVSVPVDKLINKAYAKKIFDTIQPDTVT--PSS----QIKPG------MGQLHE--GSNTTHYSVADRWGNA 392
gi 596034    411 RLGdFEGEALPKHIEEVLDPEWALKAVKSIKRNSQDgnFKTlenwTLYDP------AYDINN--PHGTAHFSIVDSHGNA 482
gi 489320514 295 AVL-TDPAFADIPLERLLDKRYAKQLAEEIGYLAI-------------PA------ESRPV---GSDTAYAAVIDADGNA 351
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2E0W_A       380 VAVTYTLNTTFGTGIVAGESGILLNNQMDDFSAKPgvpnvyglvgG--------D----------ANAVGPNKRPLSSMS 441
gi 121147    404 VAVTYTLNTTFGTGIVAGESGILLNNQMDDFSAKP----------GvpnvyglvGg--------dANAVGPNKRPLSSMS 465
gi 1707899   416 VSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAIP----------G--------G----------ANEVQPNKRPLSSMT 467
gi 2494731   350 ASLTSS-NGE-GSGHFIPGTGIMLNNMLGEEDLNP----------Q--------G----------FYQWPPGQRLSSMMA 399
gi 447177215 393 VSVTYTINASYGSAASIDGAGFLLNNEMDDFSIKP----------G--------NpnlyglvggdANAIEANKRPLSSMS 454
gi 596034    483 VSLTTTINLLFGSLVHDPKTGVIFNNEMDDFAQFN----------Ksnsf-elaPs--------iYNFPEPGKRPLSSTA 543
gi 489320514 352 VSFIQSLYFEFGSAVTAGDTGILLQNRGSFFSLDE----------N--------H----------VNTLEPRKRTFHTLM 403
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2E0W_A       442 PTIVVKDG-KTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP----DELRVEK--GFSPDTLKLLE 514
gi 121147    466 PTIVVKDG-KTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP----DELRVEK--GFSPDTLKLLE 538
gi 1707899   468 PTILFKDD-KPVLTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSM-----SSYRYED--GVPKDVLSKLN 539
gi 2494731   400 PTILLDQE-QPRLVLGSGGSNRIRSAILQVVCHHLDYQLPLAEAVGRERIHWEAH------KLDLEPt-SVADILAQLRF 471
gi 447177215 455 PTIVLKNN-KVFLVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLP----DELRIEKf-GMPADVKDNLT 528
gi 596034    544 PTIVLSELgIPDLVVGASGGSRITTSVLQTIVRTYWYNMPILETIAYPRIHHQLLP----DRIELESfpMIGKAVLSTLK 619
gi 489320514 404 PAMVCKGG-KPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWgeeyEGLRVEG--RFTDKTIQKLK 480
                        570       580       590       600
                 ....*....|....*....|....*....|....*....|.
2E0W_A       515 AKGqkVALKEA----MGSTQSIMVGPDGEl---YGASD-PR 547
gi 121147    539 AKGqkVALKEA----MGSTQSIMVGPDGEl---YGASD-PR 571
gi 1707899   540 GMGhkFGTSPVd---IGNVQSISIDHENGt--fKGVADsSR 575
gi 2494731   472 DDGtqGTLWTEqnmfFGGVHGVATTTAGTm---EGVGD-PR 508
gi 447177215 529 KMGyqIVTKPV----MGDVNAIQVLPKTKgsvfYGSTD-PR 564
gi 596034    620 EMG--YTMKEVf--pKSVVNAIRNVRGEW----HAVSDyWR 652
gi 489320514 481 DSGhlVEVVGDydplMGQAAAIKVDEEGFl---QGGAD-PR 517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap