1P9P


Conserved Protein Domain Family
trmD

?
TIGR00088: trmD 
Click on image for an interactive view with Cn3D
tRNA (guanine-N1)-methyltransferase
This model is specfic for the tRNA modification enzyme tRNA (guanine-N1)-methyltransferase (trmD). This enzyme methylates guanosime-37 in a number of tRNAs.The enzyme's catalytic activity is as follows: S-adenosyl-L-methionine + tRNA = S-adenosyl-L-homocysteine + tRNA containing N1-methylguanine. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129196
View PSSM: TIGR00088
Aligned: 9 rows
Threshold Bit Score: 377.133
Threshold Setting Gi: 3915141
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P9P_A         7 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAG- 85
gi 1174776     1 MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGe 80
gi 3915143     1 MKIDFLTLFPEMFEGVLGSSILQKAQEKDAVQFQVVNFREYSDNKHNTVDDYPYGGGAGMVLKPQPVFDAVEDLTSKAAa 80
gi 2499064     1 MQFDVLTLFPDFFTSPLQSGLLGKALEKAIASVNLINPRDFTTDKHRRVDDEPYGGGVGMVIKPEPIFAAVESLPVLSKr 80
gi 3915146     1 MKFTVLSLFPAIIKPFFENSIMKKAINKGIVSFELVDVRDFSKDKHKRCDDLPYGGGAGMVLKAEPISFALEHVESAKK- 79
gi 1351301     1 MKITVLTLFENTIWPYLNSSIMLQAQKANLVQFEVVNWRNFCNDKHKTVDDMAYGGGSGMVLKAEPIINCLNFYKAPNS- 79
gi 3915141     1 MKFSVLTLFPQLVWPYFEDSILKRALEKNLFELEVLNLRDFSANKYQKADHTLIGGGAGQILDPEMVENALHSVKNPKH- 79
gi 516102376   1 mkitvltlfeqvvwpylnasiMAQAQKAKLVEFEVINWRQYCKDKHQTVDDMAYGGGGGMVLKAEPILKALKACRTPQS- 79
gi 136249      1 MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGe 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P9P_A        86 --EgakVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIP 163
gi 1174776    81 gaK---VIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIP 157
gi 3915143    81 apR---IILVCPQGERFTQKKAEQLAKEEHLLFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLP 157
gi 2499064    81 --E---VILMTPQGQPMDQALFRELTNYDQLVLICGHYEGVDERVCQ-LVTREVSLGDFVLTCGEIPALTLINGVIRLLP 154
gi 3915146    80 --T---TIFLSPSGIKYSQELAYSLSKREEIVIICGRYEGIDQRIIDLYVDFEISIGDYVLSSGEIAALVLIDSVYRLLD 154
gi 1351301    80 --H---VVLLSPEGEQFSQNCAKKLTKYEHLILLSGHYEGFDQRIYK-YIDQIVSLGDFVLSGGELVALSVIDATVRLIK 153
gi 3915141    80 --T---IFLSAVGKPFKQTDAMR-LAQKKHVVLVCGRYEGFDERSIELGADEVFCIGDFILTGGELGALCLIDSIARHIQ 153
gi 516102376  80 --K---VVLLSPEGQQFSQPMAQALTQTEHLILICGHYEGFDYRLYK-HVDQIISLGDFVLSGGELVALSVIDATVRLIK 153
gi 136249     81 gaK---VIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIP 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P9P_A       164 GVLGHEASATEDSF--AEGLLDCPHYTRPE----VLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENl-ALT 236
gi 1174776   158 GVLGKQASAEEDSF--ADGLLDCPHYTRPE----VLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGl-ALT 230
gi 3915143   158 GVLGKEASHIEDSF--STGLLEHPHYTRPA----DYKGLKVPETLLSGNHAKIEEWRNKESIRRTYLRRPDLLKDh-PLT 230
gi 2499064   155 GTVGKEASLIAESF--STDLLDYPHYTRPP----VFRGLAVPPVLLSGNHQAIAQWRLEQQEERTQQRRPDLWQKwqDRQ 228
gi 3915146   155 GVINPN-SLLEESFgvKNGLLEYPHYTRPY----DFKGIKVPEVLLSGHHANIKNWRLVKAREKTKKNRYDLYLKylEII 229
gi 1351301   154 GVINDQ-SLICESF--NDNLLDFPVYTRPY----DLKGDKVPEVLLSGDHQKIESFRKEQQILKTAKYRPDLYKKylENK 226
gi 3915141   154 GVLGNAQSLENESF--ENHYLEAPNFANAVfkskEINKIPAPLEYSKGNHAKIKQLKLDLSKLRTKFYRLDLFKQhkS-- 229
gi 516102376 154 GVINDQ-SLIHESF--NNYLLDFPAYTRPY----DLDGDKVPEILLSGDHKKIEAYRKEQQLLRTAQYRPDLYKQylAKK 226
gi 136249    158 GVLGHEASATEDSF--AEGLLDCPHYTRPE----VLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENl-ALT 230

                 ....*
1P9P_A       237 EEQAR 241
gi 1174776   231 DEQRK 235
gi 3915143   231 EQQRK 235
gi 2499064   229 PSP-- 231
gi 3915146   230 GEDNG 234
gi 1351301   227 NEKNK 231
gi 3915141       -----
gi 516102376 227 DEKNK 231
gi 136249    231 EEQAR 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap