1JAL


Conserved Protein Domain Family
TIGR00092

?
TIGR00092: TIGR00092 
Click on image for an interactive view with Cn3D
GTP-binding protein YchF
This predicted GTP-binding protein is found in a single copy in every complete bacterial genome, and is found in Eukaryotes. A more distantly related protein, separated from this model, is found in the archaea. It is known to bind GTP and double-stranded nucleic acid. It is suggested to belong to a nucleoprotein complex and act as a translation factor. [Unknown function, General]
Statistics
?
PSSM-Id: 129200
View PSSM: TIGR00092
Aligned: 7 rows
Threshold Bit Score: 493.524
Threshold Setting Gi: 732143
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JAL_A         1 MgFKCGIVGLPNVGKSTLFNALTKAGI-EAANYPFCTIEPNTGVVPMPDPRLDALAEIVKPERI-LPTTMEFVDIAGLVA 78
gi 1351788     1 M-LSAGIVGLPNVGKSTLFSAITNLQV-EIANYPFATIEPNTGIVNVSDERLDKLASLINPEKI-VYTTFRFVDIAGLVK 77
gi 2495122     1 M-LSAGIVGLPNVGKSTLFSAITNLQV-EIANYPFATIEPNAGIVNVIDERLDKLASLIKPDKV-THTTFRFVDIAGLVK 77
gi 586477     20 NlKAGIVGLANVGKSTFFQAITRCPLGnPANYPFATIDPEEARVIVPSPRFDKLCEIYKKTASEvPAHLTVYDIAGLTKG 99
gi 446428011   1 MgFKCGIVGLPNVGKSTLFNALTKAGI-EAANFPFCTIEPNTGVVPMPDPRLDQLAEIVKPQRT-LPTTMEFVDIAGLVK 78
gi 732143     16 NpTSGIVGLANVGKSTFFQAITNSKLGnPANYPFATIDAECAKVNIPSVPLSNLLRIYQSAKCV-PGTLTIYDIAGLTRG 94
gi 499174990   1 -mLRAGIVGLPNVGKSTLFNALVANAKaEAANFPFCTIEPNVGVVSVPDDRLGKLAEISQSVKV-VPTRMEFVDIAGLVA 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JAL_A        79 GASKGEGLGNKFLANIRETDAIGHVVRCFENDDIVHVAGKIDPLDDIDTINTELALADLDSCE-------RAIQRLQKRA 151
gi 1351788    78 GASQGQGLGNQFLANIREVDLICHVVRCFQDKKIVHVNNTIDPVFDFEIIVNELIQADFELIT-------NRIGKLKRKA 150
gi 2495122    78 GASKGEGLGNQFLANIREVDLICHVVRCYEDKKIVHVNNQVDPVFDFEIIVNELIQADIEVVN-------TRIGKIKRKA 150
gi 586477    100 ASAGEGLGNAFLSHIRSVDSIYQVVRCFDDAEIIHVEGDVDPVRDLEIINQELRLKDIEFAQKaleg-aekIAKRGGQSL 178
gi 446428011  79 GASKGEGLGNQFLTNIRETEAIGHVVRCFENDNIIHVSGKVNPADDIEVINTELALADLDTCE-------RAIHRVQKKA 151
gi 732143     95 ASQGHGLGNKFLNDIRHVEGIFQVVRGFLKEDITHIEGNVDPVRDLSVVQDELILKDLEFLENirerlskKMRMVSKNSK 174
gi 499174990  79 GASKGEGLGNQFLANIREVDAIVHVVRCFDDDDIIHVSGSVDPVRDVEVIDLELVLADLAQVE-------KRLERSRKQA 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JAL_A       152 KGGdKEAKFELSVMEKILPVLENAGMIRSVg--LDKEELQAIKSYNFLTLKPTMYIANVNEDGFEN--NPYLDRVREIAA 227
gi 1351788   151 ESGdKIAKEEFVLLEIVLNGLKQGQMPIQT---LSESELKTIKSLNLLTAKPILIVANVSENDLLNldNNEALKKLNAFL 227
gi 2495122   151 ESGdKQSKEEYQLLAPVLQGLQQNQMVLHL---VNEVDLKKLKSLNLLTAKPILVVANVSEADLSNldHNPHLTQLNQFL 227
gi 586477    179 EVK-QKKEEMDLITKIIKLLESGQRVANHSw--TSKEVEIINSMFLLTAKPCIYLINLSERDYIRKknKHLLRIKEWVDK 255
gi 446428011 152 KGGdKDAKAELAVLEKCLPQLENAGMLRALd--LSAEEKAAIRYLSFLTLKPTMYIANVNEDGFEN--NPYLDQVREIAA 227
gi 732143    175 EHQ-EMKIETELLDALEEHLFNGKKIRHFKdhwNLDEVKILNKHNFLTSKPTLILLNVSPQDYVRNenKFVRNIIEWINE 253
gi 499174990 152 RGN-KDLLEEVAILERLVAALNEGIPARRVg--LTAEEQELIKSLGLLTLKPIIYATNVTEDDLAGg-NDWVEQVKAIAA 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JAL_A       228 --KEGAVVVPVCAAIESEIAELDDEEKVEFLQDLGi------EEP-GLNRVIRAGYALLNLQTYFTAGVKEVRAWTVSVG 298
gi 1351788   228 dqKKIPKAITVCSLIEKELSGLKLEQRQYFLDELGl------KNYsGLNRVIQAAYQTLNLWSFFTFGKKEVRAWTFKKG 301
gi 2495122   228 kqHNLPHAIPVCALLENELSSLDANGRQDWLKELGl------SDYqGLNQLIKTAYDAIGLWSFFTFGKQEVRAWAFKKG 301
gi 586477    256 ysPGDLIIPFSVSLEERLSH--MSPEDAEEELKKLq------TISaLPKIITTMRQKLDLISFFTCGPDEVREWTIRRGT 327
gi 446428011 228 --KEGSVVVPVCAAVEADIAELDDEERDEFMQELGl------EEP-GLNRVIRAGYKLLNLQTYFTAGVKEVRAWTIPVG 298
gi 732143    254 fsPGDKFLLFSAEFESQLMECKGIASEYFDKIKEDtnvsdqqLVSaIPQIILEMRKLLNLISFFTCGPQEVHQWNIREGT 333
gi 499174990 228 --KDEAKVVVISAQVESELVELPEEERQDFLASLGv------TEG-GLKSLIRATYELLGLRTYLTTGPQETRAWTIISG 298
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
1JAL_A       299 ATAPKAAAVIHTDFEKGFIRAEVIAYEDFIQFN---GENGAKEAGKWRLEGKDYIVQDGDVMHFRFN-V 363
gi 1351788   302 WNAPQCAGQIHSDFEKGFIKVEVISWDQLFAMK---SLQEAKKQGLIRLEGKNYLIKDGDVCNFKFN-V 366
gi 2495122   302 WLAPQCAGEIHTDFERGFIKVEVISWNQLYELK---SLQEAKKQGLVRLRG----QGLRDARWWCVS-L 362
gi 586477    328 KAPQAAGVIHNDLMNTFILAQVMKCEDVFEYKD---DSAIKAAGKLMQKGKDYVVEDGDIIYFRAGAgK 393
gi 446428011 299 ATAPQAAGKIHTDFEKGFIRAQTISFEDFITYK---GEQGAKEAGKMRAEGKDYIVKDGDVMNFLFN-V 363
gi 732143    334 TAQEAAGVIHSDLRETFISADVIKYDDLKKMEPplnESLLKSKGLIKRAGKQYIMQDNDIALFKAAGgK 402
gi 499174990 299 MKAPQAAGVIHTDFERGFIRAETVAYEDLISCG---SMQGAKEKGLVRSEGKEYVVQEGDVLLFRFN-V 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap