Conserved Protein Domain Family
TIGR00096

?
TIGR00096: TIGR00096 
16S rRNA (cytidine(1402)-2'-O)-methyltransferase
This protein, previously known as YraL, is RsmI, one of a pair of genes involved in a unique dimethyl modification of a cytidine in 16S rRNA. See pfam00590 (tetrapyrrole methylase), which demonstrates homology between this family and other members, including several methylases for the tetrapyrrole class of compound, as well as the enzyme diphthine synthase. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129204
View PSSM: TIGR00096
Aligned: 6 rows
Threshold Bit Score: 325.238
Threshold Setting Gi: 15645177
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176815     7 ILYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGLLLSHY-----------GIKKPFFALHDHNEQEKAHILVEKL 75
gi 1176814    14 LYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFG-----------INARLFALHDHNEQQKAETLLAKLQ 82
gi 1351471     4 LKVVATPIGNIQEISERAKKALQDCEVLFCEDSRVTRKMLDLLN-----------IDCKQKKFVINNSFKEKQNLTFAEE 72
gi 2496279     4 LKVIATPIGNIEEVSPRVKAALTKCEVLFCEDTRVTKKLLGLLG-----------IDFSNKQFIINNEFKEKQNLSKVAN 72
gi 2829612     3 ILYLVATPIGNLGDMTPRAVETLQTVDLIAAEDTRHTGKLLQHF-----------QITTPQISYHDHNRHGRTQELLAKL 71
gi 446888031   1 MLYFLPTPIGNLADITLRALEVLERCEVFLCEDTRVSKRLLHLLaqnpiishsfpNIATKKREFIAFHSHNDQEFLNQIK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176815    76 KQGSN--IALISDAGTPLISDPGFHLVRQCREAG--IRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLE 151
gi 1176814    83 EGQNI--ALVSDAGTPLINDPGYHLVRTCREAGI--RVVPLPGPCAAITALSAAGLPSDRFCYEGFLPAKSKGRRDALKA 158
gi 1351471    73 FITNFkcCLVSDAGYPSLSDPGNEMINWIISKNKeiRIEVINGPSALMCGLITSGFKTTPLLFLGFLSHKQNQLKNYLST 152
gi 2496279    73 LIHQYhcGLVSDAGYPSVSDPGHILVEYVRTQLPqiAIEVINGPSALVCGLVTSGFPESPLLFLGFLDHKPTQVTQTLKH 152
gi 2829612    72 QAGQN--IALVSDAGTPGISDPGQELVAACGEAN--IEVIPIPGATALIAALISSGLATDRFVFEGFLSTKNRPRQQLLQ 147
gi 446888031  81 PSFFDkeIAVMSDAGMPSLSDPGMSLAAYALKHN--IQYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLKIA 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176815   152 NI------AEEDRTLIFYESTHRILDTLEDMQAVLGEERYIVLAREMTKTWETITGNTIKNLREWLLEDPNRTKGEM-VL 224
gi 1176814   159 IE------AEPRTLIFYESTHRLLDSLEDIVAVLGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMV-LI 231
gi 1351471   153 YQ------NQKSTIVFFEAVHRLENTLETVKNVFKNNDVFIGRELTKLHESHYWFNTSENTLPDIT--L---KGEFViVI 221
gi 2496279   153 YQ------NFQGTIVLFEAVHRLQQTLEVIQTVFSNTEVFVGRELTKLHESHYWFNTSAPL-PDIT--L---KGEFViVI 220
gi 2829612   148 SL------AQEERTIILYEAPHRLLATLTDLQTFLGQERSLTVARELTKYHEQFWRGTLQTAIAYF--TENTPKGEFcLV 219
gi 446888031 159 KIlnalayLEEKTPVVFYESPHRLLETLKDLNDLAKGMHLFAAKELTKLHQQYYLGEVSQIIERLQQST---IQGEWvLV 235
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 1176815   225 IVEGKPKSDnnDEISPQAVKALELIAEELPLKKAAAIVAELYGYKKNALYQFGLahL 281
gi 1176814   232 VEGHKAQEE--DLPADALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYALE--Q 284
gi 1351471   222 DNQNINHQTlsSNQYLVYEIKKLMDIGVKLKDACNYLAKKMHLKSSMLYTLFHE--S 276
gi 2496279   221 NNHHTQPVGqySDQLLKQEITQLVQMGVKVKDACHYLAKRLQLKSNKLYTLFHE--S 275
gi 2829612   220 IAGATPEDRpsFSEENLRDELRSLMAKGLTRSQASRQLAEETKLPRRQLYQLSLelE 276
gi 446888031 236 LLNEKKIEPcmGLS--------ALLELDLPPKIKAKIEAVMTQKNAKELYFQRLleE 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap