4HI0


Conserved Protein Domain Family
ureG

?
TIGR00101: ureG 
Click on image for an interactive view with Cn3D
urease accessory protein UreG
This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel. [Central intermediary metabolism, Nitrogen metabolism]
Statistics
?
PSSM-Id: 129208
View PSSM: TIGR00101
Aligned: 4 rows
Threshold Bit Score: 375.357
Threshold Setting Gi: 2501642
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HI0_E       1 MVKIGVCGPVGSGKTALIEALTRHMSKDYDMAVITNDIYTKEDAEFMCKNSVMPRERIIGVETGGCPHTAIREDASMNLE 80
gi 2507528   1 MVKIGVCGPVGSGKTALIEALTRHMSKDYDMAVITNDIYTKEDAEFMCKNSVMPRERIIGVETGGCPHTAIREDASMNLE 80
gi 2501642   5 PLRIGIAGPVGSGKTALLEALCKALRQKYQLAVVTNDIYTQEDAQFLVRAEALTPDRILGVETGGCPHTAIREDASLNLA 84
gi 1174905  18 YIKIGVAGPVGAGKTALIEKLTREIASKYSVAVITNDIYTQEDAEFLTKNSLLPPERIMGVETGGCPHTAIREDASMNLE 97
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HI0_E      81 AVEEMHGRFPNLELLLIESGGDNLSATFNPELADFTIFVIDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVM 160
gi 2507528  81 AVEEMHGRFPNLELLLIESGGDNLSATFNPELADFTIFVIDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVM 160
gi 2501642  85 AIADLEARFMPLDMVFLESGGDNLAATFSPELVDLTLYVIDVAAGDKIPRKGGPGITKSDLLVINKIDLAPMVGADLGIM 164
gi 1174905  98 AVDEMVTRFPDVEIVFIESGGDNLSATFSPDLADVTIFVIDVAQGEKIPRKGGPGITRSDLLVINKTDLAPFVGADLSVM 177
                      170       180       190
               ....*....|....*....|....*....|....*....
4HI0_E     161 ERDSKKMRGEKPFIFTNIRAKEGLDDVIAWIKRNALLED 199
gi 2507528 161 ERDSKKMRGEKPFIFTNIRAKEGLDDVIAWIKRNALLED 199
gi 2501642 165 DRDAKKMRGEKPFVFTNLKTATGLSTVVDFVEHYLPTKV 203
gi 1174905 178 ERDARRMRNGQPFIFTNLMKKENLDGVIGWIEKYALLKN 216
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap