Conserved Protein Domain Family
cit_ly_ligase

?
TIGR00124: cit_ly_ligase 
[citrate (pro-3S)-lyase] ligase
ATP is cleaved to AMP and pyrophosphate during the reaction. The carboxyl end is homologous to a number of cytidyltransferases that also release pyrophosphate. [Energy metabolism, Fermentation, Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 129230
View PSSM: TIGR00124
Aligned: 4 rows
Threshold Bit Score: 518.607
Threshold Setting Gi: 2842394
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1168960     3 FERIS-TEQK-KLSLIQTFLHQNALKLDEQIEYFVVGYNDnEQIVVCGGLAGNIIKCVAIDESLR-GSG-VALQLITELV 78
gi 1168961     5 LKRVQlLKDKpRREAIDRFLRQHQLSLEADCEMAIIAEYQ-QRLVGCGAIAGNVLKCIAIDPSLQ-GEG-LSLKLLTELL 81
gi 2842394     1 MRRDW--QNFlMACGIKNFD-DSELN---PLDITIAVYEN-EEIIGTGSIAGDVIKYVAVQETTMsGHStLFNQLMTKLE 73
gi 545286790   7 FTRVKrSENK-KMAEIAQFLHENDLSVDTTVEVFITVTRD-EKLIACGGIAGNIIKCVAISESVR-GEG-LALTLATELI 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1168960    79 DLAYTLKRPHLFIYTKPEYATLFKSCGFYIISDANPYVVLLENSATRLQKQCSLWEKMRVDGNRIGSIVMNANPFTLGHR 158
gi 1168961    82 TLAYELGRSELFLFTKPCNAALFSGAGFWPIAQAGDRAVLMENSRERLTRYCRQLAMYRQPGRKIGAIVMNANPFTLGHR 161
gi 2842394    74 NFMAVEGRFHQFVFTKPIYQKSFEYIGFKTLAECK-QGILLEKGLPDIKEYLSTIPRPKTPIDKVASVVINANPFTNGHR 152
gi 545286790  83 NLAYERHSTHLFIYTKTEYEALFRQCGFSTLTSVPGVMVLMENSATRLKRYAESLKKFRHPGNKIGCIVMNANPFTNGHR 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1168960   159 YLIEQALQQCDHLHLFIVGEDASQFSYTERFEMIQQGIFDLSNITLHSGSDYIISRATFPNYFLKDQLITDESYFEIDLK 238
gi 1168961   162 WLVEQAASQCDWLHLFVVKEDASCFSYHDRFKLIEQGITGIDKVTLHPGSAYLISRATFPGYFLKEQGVVDDCHSQIDLQ 241
gi 2842394   153 FLIEEASRNNELVYVFVLNQEASLFHTDERIALVKAGVQDLSNVIVVNGGAYIISYLTFPAYFLKHNDSAIDYQTTIDVR 232
gi 545286790 163 YLIQQAAAQCDWLHLFLVKEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFPCYFIKEQSVINHCYTEIDLK 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1168960   239 LFRLHIAQALGITHRFVGTELNCPVTAEYNRQMHYWLMDAEmNAPKINVIEIPRKTASN--HIISASTVRKHLAEKNWAQ 316
gi 1168961   242 LFRERLAPALQITHRFVGTEPLCPLTRNYNQRMKSLLEAPG-DAPPIEVVELARIEKNG--GPVSASRVRELYRQRNWQA 318
gi 2842394   233 LFKYKIASALGITSRYVGSEPLSHTTNLYNQKL---ISELN---PQIEVHVIQRKLAAGdlGVISARTVREAIDKGDEAV 306
gi 545286790 243 IFRQYLAPALGVTHRFVGTEPFCRVTAQYNQDMRYWLETPTiSAPPIELVEIERLRYQE--MPISASRVRQLLAKNDLTA 320
                        330
                 ....*....|....*....
gi 1168960   317 LAEFVPMTTLNYLQKCGRF 335
gi 1168961   319 VAALVPPGTLSFLMQLAES 337
gi 2842394   307 WQKMVTETTQHFISNNLLE 325
gi 545286790 321 IAPLVPAVTLHYLQNLLEH 339
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap