2QFV,2CMJ


Conserved Protein Domain Family
nadp_idh_euk

?
TIGR00127: nadp_idh_euk 
Click on image for an interactive view with Cn3D
isocitrate dehydrogenase, NADP-dependent, eukaryotic type
This model describes a eukaryotic, NADP-dependent form of isocitrate dehydrogenase. These eukaryotic enzymes differ considerably from a fairly tight cluster that includes all other related isocitrate dehydrogenases, 3-isopropylmalate dehydrogenases, and tartrate dehydrogenases. Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the multimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs. These enzymes dehydrogenate their substates at a H-C-OH site adjacent to a H-C-COOH site; the latter carbon, now adjacent to a carbonyl group, readily decarboxylates. This model does not discriminate cytosolic, mitochondrial, and chloroplast proteins. However, the model starts very near the amino end of the cytosolic form; the finding of additional amino-terminal sequence may indicate a transit peptide. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 129233
View PSSM: TIGR00127
Aligned: 6 rows
Threshold Bit Score: 788.299
Threshold Setting Gi: 149241012
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QFV_A      17 SKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDLSVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEA 96
gi 1708403   2 TKIKVANPIVEMDGDEQTRIIWHLIRDKLVLPYLDVDLKYYDLSVEYRDQTNDQVTVDSATATLKYGVAVKCATITPDEA 81
gi 124160   18 SKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDLSVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEA 97
gi 1170478   3 RKIHGGS-VVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEK 81
gi 2497259  25 QKIKVANPIVEMDGDEMTRIIWKYIKDKLIFPFVELDIKYFDLGLPYRDETNDKVTVESAEATLKYNVAIKCATITPDEA 104
2CMJ_A       1 -KIQGGS-VVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEK 78
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QFV_A      97 RVKEFNLHKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIPGPGSLELVYKPSdp 176
gi 1708403  82 RVEEFHLKKMWKSPNGTIRNILGGTVFREPIIIPRIPRLVPQWEKPIIIGRHAFGDQYKATDVIVPEEGELRLVYKSKs- 160
gi 124160   98 RVKEFNLHKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIPGPGSLELVYKPSdp 177
gi 1170478  82 RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKd- 160
gi 2497259 105 RVKEFGLKSMWRSPNGTIRNILNGTVFREPIICKNIPRLIPGWTKPICIGRHAFGDQYRATDSVIKGPGKLKLVFVPEg- 183
2CMJ_A      79 RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKd- 157
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QFV_A     177 tTAQPQTLKVYDYKGSG-VAMAMYNTDESIEGFAHSSFKLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKF 255
gi 1708403 161 -GTHDVDLKVFDYPEHGgVAMMMYNTTDSIEGFAKASFELAIERKLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKF 239
gi 124160  178 tTAQPQTLKVYDYKGSG-VAMAMYNTDESIEGFAHSSFKLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKF 256
gi 1170478 161 -GSQKVTYLVHDFEEGGgVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSKF 239
gi 2497259 184 -QGETTDLEVYNFTGEGgVALAMYNTDESIRSFAEASMAVALEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAGWKSKY 262
2CMJ_A     158 -GTQKVTYMVHDFEEGGgVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKKYKSQF 236
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QFV_A     256 EQLGIHYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKY 335
gi 1708403 240 ESLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHFRQH 319
gi 124160  257 EQLGIHYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKY 336
gi 1170478 240 EAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMY 319
gi 2497259 263 EAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHFRVH 342
2CMJ_A     237 EAQNICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMY 316
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QFV_A     336 QKGEETSTNSIASIFAWSRGLLKRGELDNTPALCKFANILESATLNTVQQdGIMTKDLALACGNN---ERSAYVTTEEFL 412
gi 1708403 320 QQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVNTVQEdGIMTKDLALILGKS---ERSAYVTTEEFI 396
gi 124160  337 QKGEETSTNSIASIFAWSRGLLKRGELDNTPALCKFANILESATLNTVQQdGIMTKDLALACGNN---ERSAYVTTEEFL 413
gi 1170478 320 QKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFANALEEVCIETIEA-GFMTKDLAACIKGLpnvQRSDYLNTFEFM 398
gi 2497259 343 QKGGETSTNSIASIFAWTRGLAHRAKLDDNATLLDFTEKLEAACIGVVES-GKMTKDLALILHGSk-lSREHYLNTEEFI 420
2CMJ_A     317 QKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFAKALEDVCIETIEA-GFMTKDLAACIKGLpnvQRSDYLNTFEFM 395
                      410
               ....*....|...
2QFV_A     413 DAVEKRLQKEIKS 425
gi 1708403 397 DAVESRLKKEFEA 409
gi 124160  414 DAVEKRLQKEIKS 426
gi 1170478 399 DKLGENLKAKLAQ 411
gi 2497259 421 DAVAAELKTKISA 433
2CMJ_A     396 DKLGENLKAKLAQ 408
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap