Conserved Protein Domain Family
gid_trmFO

?
TIGR00137: gid_trmFO 
tRNA:m(5)U-54 methyltransferase
This model represents an orthologous set of proteins present in relatively few bacteria but very tightly conserved where it occurs. It is closely related to gidA (glucose-inhibited division protein A), which appears to be present in all complete eubacterial genomes so far and in Saccharomyces cerevisiae. It was designated gid but is now recognized as a tRNA:m(5)U-54 methyltransferase and is now designated trmFO. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129243
View PSSM: TIGR00137
Aligned: 3 rows
Threshold Bit Score: 761.753
Threshold Setting Gi: 26006757
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26006760   5 TPIHVIGGGLAGTEAAWQIAQAGVPVILTEMRPERLSPAHHSEDLAELVCSNSFGAKAGDRAAGLLQTELRQLSSLIITT 84
gi 3183519    4 QTVNVIGAGLAGSEAAWQLAKRGIQVKLYEMRPVKQTPAHHTDKFAELVCSNSLRSNTLANAVGVLKEEMRALDSAIIAA 83
gi 26006757   3 EKVIVIGGGLAGSEAAWRLANEGHRVILYEMRPKKMTPAHKTGNLAELVCSNTLGGLELTTGAGLLKAEMQKLGSLVIEA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26006760  85 ADRHAVPAGGALAVDRGIFSRSLTEQVASHPLVELRRGEVTEIPREgITVLTTGPLTSPALTEDLQQFTGMEYLSFFDAA 164
gi 3183519   84 ADECSVPAGGALAVDRHEFAASVTNRVKNHPNVTVINEEVTEIPEG-PTIIATGPLTSESLSAQLKELTGEDYLYFYDAA 162
gi 26006757  83 AKVARVPAGGALGVDRKIFSEYITEKIESHPNITLIREEVKEIPEDeVVVIATGPLTSDALSEKIKELVGYDTLYFYDAI 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26006760 165 SPIVVGDSINKEVAFFASRYDKGEAAYLNCPFNREQYFNFWQALCEAEQAPLKDFdrETAKFFEGCLPIEELAQRGEDTM 244
gi 3183519  163 APIVEKDSLDMDKVYLKSRYDKGEAAYLNCPMTEEEFDRFHEALTSAETVPLKEF--EKEIFFEGCMPIEVMAKRGKKTM 240
gi 26006757 163 APIVEAESVDFSKGFWGSRYGKGGDDYFNCVLTEEEYKKFYEELLKAEKVKPKDF--EKAVHFEGCLPIEEMAERGYKTL 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26006760 245 RYGPLKPVGLFDARLGdfrdpankeKKPYAVVQLRQEDKAGQLWNMVGFQTNLRWGEQGRVFRLIPGLENAEFVRMGVMH 324
gi 3183519  241 LFGPMKPVGLEHPVTG---------KRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGDQKEVLKLIPGLENVEIVRYGVMH 311
gi 26006757 241 LFGPMKPVGLVDPRTG---------KEPFAVVQLRKENKEGTLLSLVGFQTKLTYKEQKRVFRLIPCLRNAVFVRLGSMH 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26006760 325 RNTFINSPQLLTASLHFGDRQTLFAAGQLVGTEGYAAATAGGWLAGTNAARLALGLPLLTLPATTMMGALFNFISSASPK 404
gi 3183519  312 RNTFINSPSLLKPTYQFKNRSDLFFAGQMTGVEGYVESAASGLVAGINAAKLVLGEELVIFPQETAIGSMAHYITTTNQK 391
gi 26006757 312 RNTFIQSNKVLTHYLNLKKKENIFFAGQITGVEGYVASSATGILAGINAGRLARGEKPLKAPTETMLGALVNYIVTK-EG 390
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....
gi 26006760 405 HFQPMPPNFGILPELPQRIRNKQERYGQYRDRALADLTTWQTSI 448
gi 3183519  392 NFQPMNANFGLLKELPVKIKNKKERNEQYANRAIETIQTISKTI 435
gi 26006757 391 ELQPMNPVFGLLPPLEKKVRDKKKRKELMAKRALETMEKWIKEN 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap