Conserved Protein Domain Family
h_aconitase

?
TIGR00139: h_aconitase 
homoaconitase
Homoaconitase is known only as a fungal enzyme from two species, where it is part of an unusual lysine biosynthesis pathway. Because this model is based on just two sequences from a narrow taxonomic range, it may not recognize distant orthologs, should any exist. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures, but 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble leuC and leuD over their lengths but are even closer to the respective domains of homoaconitase, and their identity is uncertain. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 129245
View PSSM: TIGR00139
Aligned: 2 rows
Threshold Bit Score: 1351.63
Threshold Setting Gi: 1346476
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1346476  20 GQNLTEKIVQSYAVNLPEGKVVHSGDYVSIKPAHCMSHDNSWPVALKFMGLGATKIKNPSQIVTTLDHDIQNKSEKNLTK 99
gi 1628374  65 PQTLTEKIVQKYSVGLPQGKFVKSGDYVTIQPHRCMTHDNSWPCALKFMSIGASRLHNPDQIVMTLDHDVQNKSDKNLKK 144
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1346476 100 YKNIENFAKKHHIDHYPAGRGIGHQIMIEEGYAFPLNMTVASDSHSNTYGGLGSLGTPIVRTDAAAIWATGQTWWQIPPV 179
gi 1628374 145 YRQIEEFATQHGVEFYPAGRGIGHQIMIEEGFAWPGTLAVASDSHSNMYGGVGCLGTPIVRTDAASVWATGKTWWQIPPV 224
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1346476 180 AQVELKGQLPQGVSGKDIIVALCGLFNNDQVLNHAIEFTG--DSLNALPIDHRLTIANMTTEWGALSGLFPVDKTLIDWY 257
gi 1628374 225 AKVTFKGVLPPGVTGKDVIVALCGLFNKDDVLNHAIEFTGseETMRSLSVDTRLTIANMTTEWGALSGLFPIDSVLKGWL 304
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1346476 258 KNR--LQKLGTNNHPRINPKTIR----ALEEKAKIP-KADKDAHYAKKLIIDLATLTHYVSGPNSVKVSNTVQDLSQQDI 330
gi 1628374 305 RGKatTAAMGLADGPFKTRAAERfthpLLEQLFENPlTADKGAKYAKELFLDLSSLSPYVSGPNSVKVATPLKELEAQNI 384
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1346476 331 KINKAYLVSCTNSRLSDLQSAADVVCPTGDLN--KVNKVApGVEFYVAAASSEIEADARKSGAWEKLLKAGCIPLPSGCG 408
gi 1628374 385 KVDKAYLVSCTNSRASDIAAAAKVFKEAAEKNggKIPKIH-GVKFYIAAASIPEQLAAEGNGDWQTLLEAGATQLPAGCG 463
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1346476 409 PCIGLGAGLLEPGEVGISATNRNFKGRMGSKDALAYLASPAVVAASAVLGKISSPAEVLSTS---EIPFS---GVKTE-- 480
gi 1628374 464 PCIGMGQGLLEPGEVGISASNRNFKGRMGSTEAKAYLGSPEVVAASALSGKLSGPGWYQTPEgwtEVIRGegdGIREEdr 543
                      490       500       510       520       530       540       550       560
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1346476 481 -------------IIENPVVEEEVNAQTEAPKQS------VEILEGFPREFSGELVLCDADNINTDGIYPGKYTYQDDVP 541
gi 1628374 544 mltneealekiigQLDDLVADGEKRFASETPAVEeseqglTEIYPGFPERVSGELVFCDADNVNTDGIYPGKYTYQDDVP 623
                      570       580       590       600       610       620       630       640
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1346476 542 KEKMAQVCMENYDAEFRTKVHPGDIVVSGFNFGTGSSREQAATALLAKGINLVVSGSFGNIFSRNSINNALLTLEIPALI 621
gi 1628374 624 PETMARVCMENYDPEFSTTAKEGDILVSGFNFGCGSSREQAATAILAKKIPLVVSGSFGNIFSRNSINNALMGLEVPRLV 703
                      650       660       670       680       690       700       710
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1346476 622 KKLREKYQGAPKELTRRTGWFLKWDVADAKVVVTEGslDGPVILEQKVGELGKNLQEIIVKGGLEGWVKSQL 693
gi 1628374 704 NRLRETFGSGDKVLTRRTGWTLTWDVRKSQIEVQEG--PGGPKWTHKVGELPPNVQEIIAKGGLEKWVKNAI 773
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap