1CFZ


Conserved Protein Domain Family
hupD

?
TIGR00140: hupD 
Click on image for an interactive view with Cn3D
hydrogenase expression/formation protein
valid names: hupD, hynC, hoxM. C at 64 and 67 are believed to be metal binding. Postulated to be involved in processing or hydrogenase. Superfamily suggests that it is a peptidase/protease. [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 129246
View PSSM: TIGR00140
Aligned: 15 rows
Threshold Bit Score: 174.798
Threshold Setting Gi: 401579
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CFZ_A        20 VRIVEALEQRYILPDYVEILDGGTAGMELLGDMANRDHLIIADAIVSKkNAPGTMMILRDEEVPALF-TNKISPHQLGLA 98
gi 123911     23 VRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASHLLILDAIDYG-LEPGTLRTYAGERIPAYLsAKKMSLHQNSFS 101
gi 311538     27 VRAVEEFHRRYAVPDNVTILDGGTQGLYLVNYLEEADRLIVFDAIDYG-LEPGRLKLVRDDEVPRFTgAKKMSLHQTGFQ 105
gi 8134498    24 VRAVEALQRHWVMSSNVQLLDGGTQGIYLVDRVRKADVLVVFDAVDYG-LPPGTMKRVEDDEVPRFLgAKKMSLHQTGFQ 102
gi 729754     23 VRCVELLNERYRFPDGVRLMDGGTQGIYLVQHVQQADCLIVFDAVDYG-LAPGTLKIVRDDEVPRFMgAKRMSLHQTGFQ 101
gi 399963     26 VRCVERMAETHALPANVRLLDGGTQGLYLLPFLEEAEALIVFDAVDFG-FTPGTLVTMRDDDVPAFMgAKKMSLHQTGFQ 104
gi 1708373    20 VRIVEALEQRYILPDYVEILDGGTAGMELLGDMANRDHLIIADAIVSKkNAPGTMMILRDEEVPALF-TNKISPHQLGLA 98
gi 3021360    25 VRLVEHLEARYDFSEQVTLFDGGTLGMRLMGPIMECDLLIVLDAVLGG-DEPGAMYRLTGDDLRKSL-AFKNSMHQTDLV 102
gi 492842905  25 VRAVERLLETHDFSDNVTLMDGGNLGMKLMAPLMECDYCIVLDAVLGG-DAPGTIYRLTGEDLRKSL-AFKDSMHQSDLV 102
gi 499182856  19 VRTVEELQRRYEFPENVKVLDGGTLGIDLLYHIEGTEKLLIIDAVLGG-KKPGTFYKIKNENVKKYF-KSKVSMHELGIQ 96
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
1CFZ_A        99 DVLSALRFTGEFPkKLTLVGVIPESLEPHIG-LTPTVEAMIEPALEQVLAALRESG 153
gi 123911    102 EVLALADIRGHLPaHIALVGLQPAMLDDYGGsLSELAREQLPAAEQAALAQLAAWG 157
gi 311538    106 EVISAADLLGRCPkHLVLIGCQPLDLEDWGGpLTPPVRDQIAPAIDLACQVLAEWG 161
gi 8134498   103 EVLALAAMLGDYPkHLLLIGVQPVELDDFGGsLRPQIKERITPAIEMALEYLAQFG 158
gi 729754    102 DVLALAAFSGAYPrELLLIGVQPEELEDFGGsLREPVRAQLEPALRVALEFLAERG 157
gi 399963    105 DVIATAQLMGYCPsRMTLIGCQPVELEDYGGsLRPAVAGQIDFAIAEAVRELRAWG 160
gi 1708373    99 DVLSALRFTGEFPkKLTLVGVIPESLEPHIGlTP-TVEAMIEPALEQVLAALRESG 153
gi 3021360   103 DTLIFCQLAGHCP-EAVIIGMEPFDYETMHPeISPLAQERLPLMAEVALKEIAAHG 157
gi 492842905 103 DTLIYCELAGHRP-DTVVIGMEPLDFQNMSIeLSPAIAERVPAMIDIalaelaaag 157
gi 499182856  97 EVLALLEVLEKPIkEIVVLGLEPKSLE-VSTeLTPEIQEKIPLLVEEALSQLKEWG 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap