2IDB


Conserved Protein Domain Family
TIGR00148

?
TIGR00148: TIGR00148 
Click on image for an interactive view with Cn3D
UbiD family decarboxylase
The member of this family in E. coli is UbiD, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase. The family described by this model, however, is broad enough that it is likely to contain several different decarboxylases. Found in bacteria, archaea, and yeast, with two members in A. fulgidus. No homologs were detected besides those classified as orthologs. The member from H. pylori has a C-terminal extension of just over 100 residues that is shared in part by the Aquifex aeolicus homolog. [Unknown function, General]
Statistics
?
PSSM-Id: 129252
View PSSM: TIGR00148
Aligned: 10 rows
Threshold Bit Score: 441.434
Threshold Setting Gi: 6686190
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IDB_A       9 LRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLR--AGGPALLFENP--------KGYSXPVLCNLFGTPKRVAXGXG 78
gi 6686172   5 LRGFIQLLETRGQLRRITAEVDPDLEVAEISNRMLQ--AGGPGLLFENV--------KGSPFPVAVNLMGTVERICWAMN 74
gi 6686084   6 LREFIGRLEDKGELARVKHEVSPILEMSEVADRTVK--AGGKALLFERP--------KGYDIPVFMNAFGTERRMKLALE 75
gi 6686081   1 MRDFLKLLKKHDELKIIDTPLEVDLEIAHLAYIEAKkpNGGKALLFTQPirkehdqiKTFGMPVLMNAFGSFKRLDLLLK 80
gi 6686207   6 FREFLAALEKEGQLLTVNEEVKPEPDLGASARAASNlgDKSPALLFNNIy-------GYHNARIAMNVIGSWPNHAMMLG 78
gi 6686352   1 MRNFLDKIG--EEALVVEDEVSTSFEAASILREHPR-----DLVILKNL--------KESDIPVISGLCNTREKIALSLN 65
gi 6686175   1 MREIINKLN-----PIIIDKADKKFGVSRILKKYDG-----KPVYIKDV----------NGFEVVGNLC-SRETLSKIFN 59
gi 6686190   6 QKNFICLKRTFSMNLRDAISVANPVQLEEEIKHDEVvsFLKSKNLLDKPvi-----lNVEGKKVAKNFVSSRETLGKYLG 80
gi 6686209  10 FRDFIQVLKDEDDLIEITEEIDPNLEVGAIMRKAYE--SHLPAPLFKNL---------KGASKDLFSILGCPAGLRSKEK 78
gi 6686350   9 LRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLR--AGGPALLFENP--------KGYSMPVLCNLFGTPKRVAMGMG 78
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IDB_A      79 QEdvsalrevGKLLAFLKEPEPP-KgFRDLFDKLPQFKQVLNXPT--KRLRGAPCQQKIVSGDDVDLNRIPIXTCWPEDA 155
gi 6686172  75 MDhpleledlGKKLALLQQPKPPkK-ISQAIDFGKVLFDVLKAKP--GRNFFPPCQEVVIDGENLDLNQIPLIRPYPGDA 151
gi 6686084  76 VErle---eiGERLLSALEFRPS-S-FMDALKGVGMLKDFMSFIP--KKTGKAPCKEVVAES----LDKFPILKCWPKDA 144
gi 6686081  81 TPie----slQQRMQAFLHFNAPkN-FTEGLKVLKDLWDLRHIFP--KKTTR-PKDLIIKQDKEVNLLDLPVLKTWEKDG 152
gi 6686207  79 MP---------K--------DTP---VKEQFFEFAKRYDQFPMPV--KREETAPFHENEITEDINLFDILPLFRINQGDG 136
gi 6686352  66 CR---------------------------VHEITHRIVEAMENPT--PISSVGGLDGYRSGR--ADLSELPILRHYRRDG 114
gi 6686175  60 VK---------------------------KEDFIFFMLDAMEKEKegKLKINNKLKEKYIVEIPENIKNWPIPIYYEKDA 112
gi 6686190  81 VD----------------------------AYSIARELSKIEDRE--AEIRVEPFSSLAMKKVDVNLQELPVIKYFPRDG 130
gi 6686209  79 GD--------HGRIAHHLGLDPKtT-IKEIIDYLLECKEKEPLPPitVPVSSAPCKTHILSEEKIHLQSLPTPYLHVSDG 149
gi 6686350  79 QEdvsalrevGKLLAFLKEPEPPkG-FRDLFDKLPQFKQVLNMPT--KRLRGAPCQQKIVSGDDVDLNRIPIMTCWPEDA 155
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IDB_A     156 A-PLITWGLTVTRGPHK----ERQNLGIYRQQLIGKNKLIXRWLSHRGGALDYQEwcAAHPGERFPVSVALGADPATILG 230
gi 6686172 152 G-KIITLGLVITKDCET----GTPNVGVYRLQLQSKTTMTVHWLSVRGGARHLRK--AAEQGKKLEVAIALGVDPLIIMA 224
gi 6686084 145 G-RFITFPVVITKDPET----GEMNAGMYRMQVFDGKTTGMHWQIHKHGAEHFRKm-AEKGGGKIEVAVAIGVDPATLYA 218
gi 6686081 153 G-AFITMGQVYTQSLDH----QKKNLGMYRLQVYDKNHLGLHWQIHKDSQLFFHE--YAKAKVKMPVSIAIGGDLLYTWC 225
gi 6686207 137 G-YYLDKACVISRDLEDpdnfGKQNVGIYRMQVKGKDRLGIQPVPQHDIAIHLRQ--AEERGINLPVTIALGCEPVITTA 213
gi 6686352 115 G-PYITAGVIFARDPDT----GVRNASIHRMMVIGDDRLAVR-IVPRHLYTYLQK--AEERGEDLEIAIAIGMDPATLLA 186
gi 6686175 113 G-AYITSGVVVVYDKDY----G-YNLSIHRILVK-DDYLVIRMVEQRHLHFLYNK--ALKEKGYLDVAIVIGVHPAVLLA 183
gi 6686190 131 G-RYITAGIVIAQR-N-----GVYNASIHRMLLLDESRVAARLVPPRHTYLMWRE--AVEREEELEVAVVIGTHPLFLFA 201
gi 6686209 150 GkYLQTYGMWILQTPDK----KWTNWSIARGMVVDDKHITGLVIKPQHIRQIADSwaAIGKANEIPFALCFGVPPAAILV 225
gi 6686350 156 A-PLITWGLTVTRGPHK----ERQNLGIYRQQLIGKNKLIMRWLSHRGGALDYQEwcAAHPGERFPVSVALGADPATILG 230
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IDB_A     231 AVTPVPDTLSEYAFAGLLRGTKTEVVKCISNDLEVPASAEIVLEGYIEQGETAPEGPYGDHTGYYNEVD--SFPVFTVTH 308
gi 6686172 225 AATPIPVDLSEWLFAGLYGGSGVALAKCKTVDLEVPADSEFVLEGTITPGEMLPDGPFGDHMGYYGGVE--DSPLVRFQC 302
gi 6686084 219 ATAPLPSGISEFMFAGFIRKERLKVTECETVDLLVPANAEIILEGYVRVDEMRVEGPFGDHTGYYTPPE--PYPVFHITH 296
gi 6686081 226 ATAPLPYGIYELMLYGFMRGKKARVMPCLSNSLSVPSDCDIVIEGFVDCEKLELEGPFGDHTGYYTPIE--PYPVLEVKT 303
gi 6686207 214 ASTPLLYDQSEYEMAGAIQGEPYRIVKSKLSDLDVPWGAEVVLEGEIIAGEREYEGPFGEFTGHYSGGR--SMPIIKIKR 291
gi 6686352 187 TTTSIPIDADEMEVANTFHEGELELVRCEGVDMEVPP-AEIILEGRILCGVREREGPFVDLTDTYDVVR--DEPVISLER 263
gi 6686175 184 GSTSADITFDELKFAAALLGGEIGVFELD-NGLLVPE-AEFIIEGKILP-EVDDEGPFVDITGTYDIVR--KQPIIKIEK 258
gi 6686190 202 SATRVPSG-KEFSYAAGLMG-RLTLYRKG--EMLVPD-SEIILFGRITA-ETAKEGPFVDITGTYDIVR--DEPVIVFDE 273
gi 6686209 226 SSMPIPEGVSESDYVGAILGESVPVVKCETNDLMVPATSEMVFEGTLSLTDTHLEGPFGEMHGYVFKSQghPCPLYTVKA 305
gi 6686350 231 AVTPVPDTLSEYAFAGLLRGTKTEVVKCISNDLEVPASAEIVLEGYIEQGETAPEGPYGDHTGYYNEVD--SFPVFTVTH 308
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IDB_A     309 ITQREDAIYHSTYTGRPPDE-PAVLGVALNEVFVPILQKQFPEIVDFYLP-PEGCSYRLAVVTIK-----KQYAGHAKRV 381
gi 6686172 303 LTHRKNPVYLTTFSGRPPKE-EAMMAIALNRIYTPILRQQVSEITDFFLP-MEALSYKAAIISID-----KAYPGQAKRA 375
gi 6686084 297 ITHRENPIYHATVVGKPPME-DAWLGKATERIFLPILRMMHPEIVDINLP-VEGAFHNLAIVSIK-----KRYPGQAKKV 369
gi 6686081 304 ISYKKDSIYLATVVGKPPLE-DKYMGYLTERLFLPLLQMNAPNLIEYYMP-ENGVFHNLILAKIH-----TRYNAHAKQV 376
gi 6686207 292 VYHRNNPIFEHLYLGMPWTEcDYMIGINTCVPLYQQLKEAYPNEIVAVN--AMYTHGLIAIVSTK-----TRYGGFAKAV 364
gi 6686352 264 MHIRKDAMYHAILPAGFEHR--LLQGLPQEPRIYRAVKNTVPTVRNVVLT-EGGCCWLHAAVSIK-----KQTEGDGKNV 335
gi 6686175 259 LYRKEKPIFHALLPGGIEHK--TLMGMPQEPRILKGVRNTVPTVKNIVLT-EGGCCWLHAVVQIE-----KRTEGDGKNA 330
gi 6686190 274 MYVKEDYIYYSITPAGKEHQ--MLMGVPYEPVIYRFVSN-VCKVKNVITT-PGSCHYFHCVVQIE-----KKSEGDGKNA 344
gi 6686209 306 MSYRDNAILPVSNPGLCTDEtHTLIGSLVATEAKELAIESGLPILDAFMPyEAQALWLILKVDLKglqalKTTPEEFCKK 385
gi 6686350 309 ITQREDAIYHSTYTGRPPDE-PAVLGVALNEVFVPILQKQFPEIVDFYLP-PEGCSYRLAVVTIK-----KQYAGHAKRV 381
                      410       420       430       440       450       460       470
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
2IDB_A     382 XXGVWSFLrQFXYTKFVIVCDDDV-NARDWNDVIWAITTRXDPARDTVLVENTPIDYLDFAS-PVSGLGSKXGLDATNK 458
gi 6686172 376 ALAFWSALpQFTYTKFVIVVDKSI-NIRDPRQVVWAISSKVDPVRDVFILPETPFDSLDFAS-EKIGLGGRMGIDATTK 452
gi 6686084 370 MYAIWGTG-MLSLTKIVVVVDDDV-NVHDMREVVWAVTSRFDPARDVVILPPSPTDSLDHSA-YIPNLAGKLGIDATKK 445
gi 6686081 377 MHAFWGVG-QMSFVKHAIFVNEDApNLRDTNAIIEYILENFS--KENALISQGVCDALDHAS-PEYAMGGKLGIDATSK 451
gi 6686207 365 GMRALTTPhGLGYCKMVIVVDEDV-DPFNLPQVMWALSTKMHPKHDAVIIPDLSVLPLDPGS-NPSGITHKMILDATTP 441
gi 6686352 336 IMAALAAH---PSLKHVVVVDEDI-DVLDPEEIEYAIATRVKGDDDILIVPGARGSSLDPAA-LPDGTTTKVGVDATAP 409
gi 6686175 331 ILAAFASH---PSLKHVIVVDDDI-NIFDINDVEYAIATRVQGDKDIVIISGAKGSSLDPSSdLKNKLTAKVGVDATMS 405
gi 6686190 345 IIAALAAN---PSMKGVVVVDDDI-DILSYEDMEFAIATRFQPDRDLVVVKGARGSSLDPSA---DKTTSKWGIDATKP 416
gi 6686209 386 VGDIYFRTkVGFIVHEIILVADDI-DIFNFKEVIWAYVTRHTPVADQMAFDDVTSFPLAPFVsQSSRSKTMKGGKCVTN 463
gi 6686350 382 MMGVWSFLrQFMYTKFVIVCDDDV-NARDWNDVIWAITTRMDPARDTVLVENTPIDYLDFAS-PVSGLGSKMGLDATNK 458
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap