Conserved Protein Domain Family
TIGR00149_YjbQ

?
TIGR00149: TIGR00149_YjbQ 
secondary thiamine-phosphate synthase enzyme
Members of this protein family have been studied extensively by crystallography. Members from several different species have been shown to have sufficient thiamin phosphate synthase activity (EC 2.5.1.3) to complement thiE mutants. However, it is presumed that this is a secondary activity, and the primary function of this enzyme remains unknown. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 129253
View PSSM: TIGR00149
Aligned: 6 rows
Threshold Bit Score: 202.681
Threshold Setting Gi: 3123134
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418548      4 QKTLTLSAKSRGFHLVTDEILNQLADMpRVNIGLLHLLLQHTSASLTLNENCDPTVRHDMERFFLRTVPDNGNYEHDy-E 82
gi 3025207    12 QEILVIATQGKSLHNFNSKIQAVVQHS-GVKTGLCTVFVRHTSASLIIQENADPDVLTDLAIFFAQLVPEDGRRYRHstE 90
gi 3024975     8 FKYQIKTNKREELVDITPYIISAISES-KVKDGIAVIYVPHTTAGITINENADPSVKHDIINFLSHLIPKNWNFT----H 82
gi 226693600   3 KTLQIKTTKRDEMIDITREVEAFLQET-GITSGAALIYCPHTTAGITINENADPDVKKDMLRRFDEVYPWEHELDR---H 78
gi 3123134     1 MELTLKTAKRVEIIDITDQVERCVES----RDGLVLVYTPHTTTALVINEGER-GLLEDILEFMEKLVPYGKGYKHD--R 73
gi 3123063    12 QELPLRTSRRVELIDITSMVSGVLESS-GIRNGILNVFSRHSTSAIFINENES-RLLSDIESMLEGTVPVDASYGHN--A 87
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 418548     83 GADDMPSHIKSSMLGTSLVLPVHKGRIQTGTWQGIWLGEHRIHGGSRrIIATLQGE 138
gi 3025207    91 GLDDMPAHIRSALTKTSEHIPIVNGRLGLGTWQGVFLWEHRQRPHQReVIVHVSGE 146
gi 3024975    83 LEGNSDAHIKSSLVGCSQTIIIKDGKPLLGTWQGIFFAEFDGPRRRE-FYVKIIGD 137
gi 226693600  79 MEGNTAAHMKSSTVGASQHVIVENGRLILGTWQGIYFCEFDGPRTRT-CYIKMMG- 132
gi 3123134    74 LDSNADAHLKATLLGNSVVVPVESGKLALGTWQRILFLEFDGPRTRR-VIVKAL-- 126
gi 3123063    88 IDNNADSHLRAVLLGGSQTVPVINGSMDLGTWQSIFFAELDGPRNRR-IRVSVAGK 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap