Conserved Protein Domain Family
TIGR00156

?
TIGR00156: TIGR00156 
TIGR00156 family protein
As of the last revision, this family consists only of two proteins from Escherichia coli and one from the related species Haemophilus influenzae. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129260
View PSSM: TIGR00156
Aligned: 3 rows
Threshold Bit Score: 178.957
Threshold Setting Gi: 1176141
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 401538    1 MKFQAIVLASFLVMPYALADDQGGLKqdaAPPPPHAIEDGYRGTDdAKKMTVDFAKTMHDGASVSLRGNLISHKGEDRYV 80
gi 1723887   2 KKFAAVIAVMALCSAPVMAAEQGGFS---GPSATQSQAGGFQGPN-GSVTTVESAKSLRDDTWVTLRGNIVERISDDLYV 77
gi 1176141   1 MKKFALATIFALATTSAFAGFNGNNS-----------QGGFQQAA-PAAISVKQALSAADNSMITLVGNITQQIDDDEFW 68
                       90       100       110       120       130
               ....*....|....*....|....*....|....*....|....*....|.
gi 401538   81 FRDKSGEINVVIPAAVFDGREVQPDQMINISGSLD-KKSAPAVVRVTHLQK 130
gi 1723887  78 FKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVD-KDWNSVEIDVKQIRK 127
gi 1176141  69 FTDGTGQIKIEIKKRVWNGLNVDSKDKVKIYGKLDnEVFEKAELDVLRIEK 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap