Conserved Protein Domain Family
TIGR00159

?
TIGR00159: TIGR00159 
TIGR00159 family protein
These proteins have no detectable global or local homology to any protein of known function. Members are restricted to the bacteria and found broadly in lineages other than the Proteobacteria. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129263
View PSSM: TIGR00159
Aligned: 5 rows
Threshold Bit Score: 265.524
Threshold Setting Gi: 2496300
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1351488     1 MVVNILLFITLIFLLLLFVFLI----------AFAFLNKRVRNYVVR----TWTSVFSk-SKQNLDKKNFFDNLTSTLLR 65
gi 2496300     2 MTVEVFSVIILVLLFLILALTL----------LFVLLNKRTRSFVIR----TFTGLFR--SKHTTSQKNFYDNLTSTLLR 65
gi 489316280  45 VVIVLVRMASQYLGLSTLQWLMdqaitwgflaIIIIFQPELRRALEQl--gRGRFFSRsgTPVEEAQQKTIEAITKAINY 122
gi 499176467  48 LVLMVAQLVSDRLHLELLKFVLekfvlgtavaLAVIFQAELRRFLELlgqgRFLELLRr-RSSSPPSTDAIDEIVDAVKE 126
gi 488733259  47 LIIISVGIISYYLNLYTISWLLnyianilpiaIVILFNQEIKKIIMQi--gNFNLAFKl-SNKKEETLKVISEILKAVKH 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1351488    66 LSVDKIGAIIAIEKRDSLEP--YINIGYRVSSDFSPELLVTIFYNkSSPLHDGAVIVRDYKIISVSSYFPMT-R-QLIDV 141
gi 2496300    66 LSTDKIGAIIAIENQDSLES--YVNIGYRVTSDFSPELLVTIFYNkQSPLHDGAVIVRDYQIVSVSSYFPMT-R-QLIDV 141
gi 489316280 123 MAKRRIGALLTIERDTGMGD--YIETGIPLNAKVSSELLINIFIP-NTPLHDGAVIMKNNEIAAAACYLPLS-EsPFISK 198
gi 499176467 127 LSQNRIGALMVMEAQGILDSriFLNRGVAIDSKLSKELLQTIFQP-KTLLHDGAIFIRGSRLVAAGVILPLS-E-RSASR 203
gi 488733259 124 LSENKSGSLICIEKKIQLEQ--IINKGTKIDALISSELLISLFER-ETPLHDGAVIISKNKLKYAGSFLPLSnV-DSISK 199
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1351488   142 SYGSRHRSALGLSEKSD-AVVFIVSETTGKISVALKGVIKTLSSNSDRLQDEIIHYLSSK 200
gi 2496300   142 SYGSRHRSALGLTEKCD-AIVFIVSETTGKISVAVRGVIKTLSSNSDRLQDQIIHYLTVK 200
gi 489316280 199 ELGTRHRAAVGISEVTD-SLTIIVSEETGGVSVAKNGDLHRELTEEALKEMLEAEFKKNT 257
gi 499176467 204 QLGTRHRAAMGITEKSEnCLCIVVSEETGSITLAQGGNLNRPLTSSKLKELLETEYAPPT 263
gi 488733259 200 AFGTRHRAGLGISENSD-AITIITSEETGSISITINAKLEYNLSLSEIRNKLNLELIE-- 256
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap