Conserved Protein Domain Family
TIGR00161

?
TIGR00161: TIGR00161 
TIGR00161 family protein
This model represents one out of two closely related ortholgous sets of proteins that, so far, are found only in the Archaea. This ortholog set includes MJ0106 from Methanococcus jannaschii and AF1251 from Archaeoglobus fulgidus, but not MJ1210 or AF0525. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129265
View PSSM: TIGR00161
Aligned: 3 rows
Threshold Bit Score: 364.938
Threshold Setting Gi: 2495801
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495801     2 VDSMKFV-EKAKIEFENPIVIEAFPGTGLVGSIAGFQIIKDLNLKYFGYFEVDGILPLTTIEKGIPYPPVRAYANKDF-- 78
gi 499181206   1 MELETEI-IVDKVDVENPILITSFPGIGLVGTIATAHYIMELKLESIGIVDSRLLPPVASLYEGVILPPVRVYQSADLgf 79
gi 499179377   3 IKTETECcTIYSEDVEDAVVLEGSPGVGLIGNILGWLLVEDLKMREIGYIDSKYFPPLAVLYKGVAIHPFRIYEG-DGi- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495801    79 IILFSDIIISPFKINGLAEFIVKTFSNKNPKLFVSLGGIMAGK-SEKVFGIANKEELIEDLKNY-VEIFDFGVVGGMGGN 156
gi 499181206  80 VLIHSDVPIIPQAAIDMSKKIVQFAAEINARRVYSFAGVATFEdKKRVFAAATSKELLEEVKDH-AEIFKTGTISGIAGS 158
gi 499179377  81 VLFLSDFILPPAVVYDMTNAIVEWMVRNKSRELITFNSMVVREkSQPVAGAGNSQEVIQRLADLgIPIVPFGNLNGISGT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495801   157 LLIKCHDNGFDAIGLLAETVGIRPDPRGGANLLEVLNKMFNLNVNIENLIKEAEAIENKLKELAEQHLKMMSKsRKEYPM 236
gi 499181206 159 IMNECVAAKMPGIVLLGETLGFNPDPRAAASLIEAVNKIMNWNVSVEKLLKEAEMIEAQMQKLAEQARMQEER-KEEFPM 237
gi 499179377 161 LLTRCAVNDIPASCLFAEILNPYPDPRAAASVVEVLNEMLGTSVDPEPLLQEAQAIESRLKKLAETVQG-----EAETPI 235

                 ..
gi 2495801   237 YI 238
gi 499181206 238 YG 239
gi 499179377 236 YM 237
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap