Conserved Protein Domain Family
TIGR00162

?
TIGR00162: TIGR00162 
TIGR00162 family protein
This model represents one out of two closely related ortholgous sets of proteins that, so far, are found only in but are universal among the Archaea. This ortholog set includes MJ1210 from Methanococcus jannaschii and AF0525 from Archaeoglobus fulgidus while excluding MJ0106 and AF1251. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129266
View PSSM: TIGR00162
Aligned: 3 rows
Threshold Bit Score: 277.492
Threshold Setting Gi: 11498136
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2496155    73 MCAEFYAIREP----KPMIVVLGNTQALSPIGQYHLAEEIVKIGIEYGANFVYTLGGFGVGKLCEEVKVYGATTSKELAK 148
gi 499179379   1 MRNEFYYLRDAggdeRDYIILVGNTQGLSPEGQYEICGMILDFVEGYGARRIFTLGGLATGQPVEKARVYGAATSMELVE 80
gi 499180492  73 PKNEVYAWKSDgn-gTDLLILVGDFQSISNEGHFELVNAYIDVAKKFSARMIYTLGGYGVGKLVEEPYVIGAANSPEIVE 151
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2496155   149 KLKEHDILF--RTDGGGIVGAAGLMLMFADLNGIPGICLMGETPGYLIDPNAAKAVLEKFCKLENIEINMEELEKRAKGM 226
gi 499179379  81 DLKEHGVIM--RSADGGIIGASGLLLGMGRLRGMDGVCLMGETPGYFIDAEAARALLEVLLEMTKLEVDLEKLEERAEET 158
gi 499180492 152 ELKSYGVKFepGEPGGGIIGASGLLLGVSELEGIPAACLMGVTSGYMVDPKSAKVVLDVLCKMLSLEVSVEALEERAKEM 231
                        170       180       190
                 ....*....|....*....|....*....|..
gi 2496155   227 EQFIEKIKKFEEEMLKAAQAKPpSEEDLRYIG 258
gi 499179379 159 KKMISKAQQMEQEMIERMNLKP-GEEDLRYIG 189
gi 499180492 232 EKIIAQIKEMQEMAVQQWK----SDEDLRYFR 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap