Conserved Protein Domain Family
PS_decarb_rel

?
TIGR00164: PS_decarb_rel 
phosphatidylserine decarboxylase precursor-related protein
Phosphatidylserine decarboxylase is synthesized as a single chain precursor. Generation of the pyruvoyl active site from a Ser is coupled to cleavage of a Gly-Ser bond between the larger (beta) and smaller (alpha chains). It is an integral membrane protein. This protein has many regions of homology to known phosphatidylserine decarboxylases, including the Gly-Ser motif for chain cleavage and active site generation, but has a shorter amino end and a number of deletions along the length of the alignment to the phosphatidylserine decarboxylases. It is unclear whether this protein is a form of phosphatidylserine decarboxylase or is a related enzyme. It is found in Neisseria gonorrhoeae, Mycobacterium tuberculosis, and several archaeal species, all of which lack known phosphatidylserine decarboxylase. [Unknown function, General]
Statistics
?
PSSM-Id: 129268
View PSSM: TIGR00164
Aligned: 4 rows
Threshold Bit Score: 262.431
Threshold Setting Gi: 11499627
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2833612     1 MGKYKKFFAIAVCSLLLFTVYFYRDPDRVITKGNNIILSPADGTve--yIKFYENgnpevfkdgncyvlnVSRYFPNG-C 77
gi 1143229    28 VSMCCGWWSLPFWVFTVFALQFFRDPAREIPQNPEAVLSPVDGR-----IVVVER---------------ARDPYRDVdA 87
gi 499179117  18 LFGYH-AIGILMFTVIAFMMQFFRDPDRIPPSDEDLIIAPADGRrlsgkIDRIERvgsd--------yplIDRIFPDGsG 88
gi 499181997  20 AYLLHPLISALFVGFALFTAYFFRDPERKIGEG---VVSPADGR-----IDYLE-------------------------G 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2833612    78 -YVVGIFMSPLDVHVNRAPIGGRIVYIKHIDGSFYPAFLEGVEKINERNIVIIKNGSE-YVGVVQIAGFVARRCWLSIKE 155
gi 1143229    88 -LKISIFMNVFNVHSQKSPADCTVTKVVYNKGKFVNADLDKASTENERNAVLATTASGrEITFVQVAGLVARRILCYTQA 166
gi 499179117  89 gILISTFMSPFDVHVNRAPVSGKVIYTEHVDGRFQVARSRVL-TENEKNLIVIKTDYG-NVGVIQIAGFVARRIVQYVKE 166
gi 499181997  67 -RRLEIFMSPFDCHINRAPWGGKVLSVKFIEGSTPPAFIRKSG-VRTNE-ILIETEHG-VFRVLQMAGIFARRIVSYVSE 142
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 2833612   156 GECINMGQKIGMIKLGSQTAVIIPANYNITVKVGERVYAGQTIIAVKRTDN 206
gi 1143229   167 GAKLSRGERYGFIRFGSRVDMYLPVDAQAQVAIGDKVTGVKTVLARLPLTD 217
gi 499179117 167 GEYVERGDRIGMIRFGSRVDLVLPENCEVLVKTGSRPMAGETVVARFNPGK 217
gi 499181997 143 GDVVKKGQKIGMIRFGSRVVLEVPEGFRFVRGVGEKVKAGETVALRDESFQ 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap