Conserved Protein Domain Family
leuD

?
TIGR00171: leuD 
3-isopropylmalate dehydratase, small subunit
Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. The candidate archaeal leuD proteins are not included in the seed alignment for this model and score below the trusted cutoff. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 129275
View PSSM: TIGR00171
Aligned: 4 rows
Threshold Bit Score: 346.032
Threshold Setting Gi: 2498516
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1708801 545 MKP-FLTLEGISAPLDKANVDTDAIIPKQFLKTIKRTGLKKGLFYEWRFRkDDQGKDQETDFVLNVEPWREAEILVVTgD 623
gi 266464    1 MAEkFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFL-DEKGQQPNPDFVLNFPQYQGASILLAR-E 78
gi 1170776   1 MAG-FKQLSGLVVPLDAANVDTDAIIPKQFLQAITRIGFGKHLFHEWRYL-DVEGTKPNPEFVLNYPQYQGATILLAR-K 77
gi 2498516   1 MEP-LKSHTGKAAVLNRINVDTDQIIPKQFLKRIERTGYGRFAFFDWRY--DANG-EPNPEFELNQPVYQGASILIAG-E 75
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1708801 624 NFGCGSSREHAPWALKDFGIKSIIAPSYGDIFYNNSFKNGLLPIRLDQQIIIDKLIPIA-NKGGKLCVDLPNQKILDSDg 702
gi 266464   79 NFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPVKLSDAEVDELFALVKaNPGIHFDVDLEAQEVKAGE- 157
gi 1170776  78 NLGCGSSREHAPWALADYGFKVMIAPSFADIFYNNSLNNHMLPIRLSEEEVEEIFQWVWaNEGKQIHVDLEAMTVTVGD- 156
gi 2498516  76 NFGCGSSREHAPWALDDYGFKIIIAPSFADIFHQNCFKNGMLPIRMPYDNWKQLVGQYE-NQSLQMTVDLENQLIHDSEg 154
                      170       180       190
               ....*....|....*....|....*....|....
gi 1708801 703 nvLVDHFEIEPFRKHCLVNGLDDIGITLQKEEYI 736
gi 266464  158 --KTYRFTIDAFRRHCMMNGLDSIGLTLQHDDAI 189
gi 1170776 157 --KVYTFELDEFRRHCLLNGLDNIGLTLQHEDKI 188
gi 2498516 155 --NQISFEVDPHWKEMLINGYDEISLTLLLEDEI 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap