1EX2


Conserved Protein Domain Family
maf

?
TIGR00172: maf 
Click on image for an interactive view with Cn3D
MAF protein
This nonessential gene causes inhibition of septation when overexpressed. A member of the family is found in the Archaeon Pyrococcus horikoshii and another in the round worm Caenorhabditis elegans. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 129276
View PSSM: TIGR00172
Aligned: 7 rows
Threshold Bit Score: 260.408
Threshold Setting Gi: 20140423
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EX2_A         1 MTKPLILASQSPRRKELLDLLQ--LPYSIIVSEVEE---KLNRNFSPEENVQWLAKQKAKA-VADLHPHAI--------- 65
gi 401655      1 MTKPLILASQSPRRKELLDLLQ--LPYSIIVSEVEE---KLNRNFSPEENVQWLAKQKAKA-VADLHPHAI--------- 65
gi 140750      1 MTS-LYLASGSPRRQELLAQLG--VTFERIVTGIEE---QRQPQESAQQYVVRLAREKARAgVAQTAKDLP--------- 65
gi 20140488    1 MPPTFVLASASPARKRLLEMAG--ISPLVAVSHFDE---SSLAADNTVALVEALAKAKAGT-VASKFADAL--------- 65
gi 20140423    1 --MELILGSQSSTRANLLKEHG--IKFEQKALYFDE---ESLKTTDPREFVYLACKGKLEK-AKELLANNCa-------- 64
gi 446897532  14 MPK-LILASTSPWRRALLEKLQ--ISFECAAPEVDE---TPRSDESPRQLVLRLAQEKAQS-LASRYPDHL--------- 77
gi 20141019   17 SKYDIILASTSPRRYEILHDIMgiTDLKTMVSTFEEnldKMNYSTDPIGYVCDTSWHKAQN-IIEILTDYEdenpneidk 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EX2_A        66 ---VIGADTMVCLD-GECLGKPQDQEEAASMLRRLSGRS---HSVITAVSIQAEN-----HSETFYDKTEVAFWSLSEE- 132
gi 401655     66 ---VIGADTMVCLD-GECLGKPQDQEEAASMLRRLSGRS---HSVITAVSIQAEN-----HSETFYDKTEVAFWSLSEE- 132
gi 140750     66 ---VLGADTIVILN-GEVLEKPRDAEHAAQMLRKLSGQT---HQVMTAVALADSQ-----HILDCLVVTDVTFRTLTDE- 132
gi 20140488   66 ---VLGCDSLLLVN-GQTYGKPESPAVAIARWQTMRGQV---GELYTGHALIDRTq---nRCLCQTGLTKVHFADVDDD- 134
gi 20140423   65 ---IVVADSVVSVG-NRMQRKAKNKQEALEFLKRQNGHE---IEVLTCSALISPV-----LEWLDLSVFRARLKAFDPS- 131
gi 446897532  78 ---IIGSDQVCVLD-GEITGKPLTEENARLQLRKASGNI---VTFYTGLALFNSAn---gHLQTEVEPFDVHFRHLSEA- 146
gi 20141019   96 pklIICADTIIIDKsGRIYEKPKTKEVQKKFLMKFCYEDdepVNVVTAVTLIKWYgrenfELVPFRDETKVYFDNKIPLr 175
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
1EX2_A       133 EIWTYIETKEPMDKAGAYGIQGRGALFVKKIDG-DYYSVMGLPISKTMRALR 183
gi 401655    133 EIWTYIETKEPMDKAGAYGIQGRGALFVKKIDG-DYYSVMGLPISKTMRALR 183
gi 140750    133 DIAGYVASDEPLDKAGAYGIQGLGGCFVRKING-SYHAVVGLPLVETYELLS 183
gi 20140488  135 TIQAYVGSGEPLQCAGAFALEGKGGMLINKLDG-CSSNVIGLSLPILRSLLQ 185
gi 20140423  132 EIEKYLESGLWQESAGCVRLEDFHKPYIKSSSE-NLSVGLGLNVEGLLGALK 182
gi 446897532 147 EIDNYVRKEHPLHCAGSFKSEGFGITLFERLEGrDPNTLVGLPLIALCQMLR 198
gi 20141019  176 ILEEYVESGDGLEVGGGFKIQGQGAILIEKIEG-DYYNVVGLPLNKTFKGLY 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap