Conserved Protein Domain Family
thiC

?
TIGR00190: thiC 
phosphomethylpyrimidine synthase
The thiC ortholog is designated thiA in Bacillus subtilis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
Statistics
?
PSSM-Id: 129294
View PSSM: TIGR00190
Aligned: 7 rows
Threshold Bit Score: 697.27
Threshold Setting Gi: 7388298
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 417994    147 VTQLHYARQGIITPEMEFIAIRENMGrerirsevlrhqhpgmsfgahlpenitAEFVRDEVAAGRAIIPANINHPESEPM 226
gi 239938835 132 VTQMHYAKKGIITPEMEFIAIREHVS---------------------------PEFVRDEVASGRAIIPSNINHPESEPM 184
gi 3024729    15 VSQMHYARKGVITEEMDYVAKRENLP---------------------------VELIKDEVARGRMIIPANINHTNLEPM 67
gi 7388296     1 MTQMEEARKGNITPEMEEVARKENLD---------------------------IQMLIRGIANGRIVIPSNINR-ESSPC 52
gi 7388298     1 MTLIEDARKGVVTDFVKKAAEYEGIE---------------------------AEKLIRLISHGYVVLPKNVRREEVQPR 53
gi 7388295     1 MTQMDEAKKGVITDEMKAVAEAENVT---------------------------PEFVRRGVASGKIAIPSNLNREEVAAV 53
gi 499172952   1 MTQMDDAKNGIITEEMKIVAEKEKID---------------------------IEKLRKLIAKGYVVILKNVNR-DTNPV 52
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 417994    227 IIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTG-RYIHETREWILRNSPVPIGTVPIYQA---LEK 302
gi 239938835 185 IIGRNFHVKINANIGNSAVTSSIEEEVEKMTWAIRWGADTMMDLSTG-KDIHTTREWIIRNCPVPVGTVPIYQA---LEK 260
gi 3024729    68 AIGIASKCKVNANIGASPNSSNIDEEVEKLLLSVKYGADTVMDLSTGgGDLDVIRTAIINASPVPIGTVPIYQA---LES 144
gi 7388296    53 GIGENLSTKINANIGSSSKMEDIELEVDKALAAVEYGADAVMDLSTG-PMLRDVRKAVLEAVDVPVGTVPIYEAgveAFM 131
gi 7388298    54 AIGMLTSTKVNANVGTSADYINVEEEVEKAIIAQKAGADAVMDLSSG-GDLDAIRKRIMEVVEVPFGTVPIYQA---ARD 129
gi 7388295    54 GIGAGLRTKVNATIGTSTDIVDFDMEEEKARIAIENRADTLMELSVG-GDLDEIRRRILDLSPIPVGSVPVYQAaieTIR 132
gi 499172952  53 GIGQSLRTKVNANIGTSPDCVDIELEIKKAKIAEKYGADAVMDLSTG-GNLEEIRKAIMDAVKIPIGTVPIYEVgklARE 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 417994    303 VNGIAEDLTWEAFRDTLLEQAEQGVDYFTIHAGVLLRYVPMTAK--RLTGIVSRGGSIMAKWCLSHHQENFLYQHFREIC 380
gi 239938835 261 VNGVAEDLTWEIYRDTLIEQAEQGVDYFTIHAGVLLRYVPLTAK--RTTGIVSRGGAIMAQWCLAHHQESFLYTHFEEIC 338
gi 3024729   145 VHGSIENLTPDDFLHIIEKHAQQGVDYMTIHAGLLIEYLPLVKS--RITGIVSRGGGIIAKWMLHHHKQNPLYTHFDEII 222
gi 7388296   132 SDGAVVDMDEDDMFRAIENQARDGVDFMTVHSGITLETVERAQRsgRIMGIVSRGGAFLAAWIMQNQEENPLYSNYEYLL 211
gi 7388298   130 CH-RVVDMDEDDFFRVVEKHAKDGVDFMTIHAGVNWVSVERLRRskRLLGVVSRGGAITIGWMLHNEKENPYYKDFDYLL 208
gi 7388295   133 EKGASIYMDEDVMFRAIEKQAKDGIDFMAIHCSVNRETLRRLKRqgREGGLVSRGGAFVSAWMVENGLENPLYENFDYIL 212
gi 499172952 132 KYGRVIDMNEDLMFKVIEKQAKEGVDFMTLHCGITKQSVERLKRsgRIMGVVSRGGAFLTAYILYHNEENPLYKNFDYLL 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 417994    381 EICAAYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEELEHCHEAPFY 460
gi 239938835 339 EIMKMYDIAFSLGDGLRPGSIADANDEAQFAELETLGELTQIAWKHDVQVMIEGPGHVPMHKIKENVDKQMDICKEAPFY 418
gi 3024729   223 EIFKKYDVSFSLGDSLRPGCTHDASDDAQLSELKTLGQLTRRAWEHDVQVMVEGPGHVPIDQIEFNVKKQMEECSEAPFY 302
gi 7388296   212 EVAYEYDVTLSLGDGLRPGCLADASDIPQISELLTLAELVERARDADVQCMVEGPGHMPLDQIAANMKIQKEVCDGAPFY 291
gi 7388298   209 EILKEYDVTISLGDAYRPGCIHDAGDRAKYTEFIMLGELVEKCREKGVQCMVEGPGHVPLDQIETSVRAMKSVTDNAPLY 288
gi 7388295   213 EIAKEHDFVLSMANAMRAGAIADSTDRAQVQELIVLGELIDRAREAGVQTIVEGPGHIPLNEIKANVILQKKLCRGAPFY 292
gi 499172952 212 DILKEHDVTISLGDGMRPGCLADNTDRAQIEELITLGELVERCREKGVQCMVEGPGHIPINYIETNIRLQKSLCKNAPFY 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 417994    461 TLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKEDVKQGLITYKIAAHAADLAK-GHPG-AQIRDN 538
gi 239938835 419 TLGPLTTDIAPGYDHITSAIGAAMIGWYGTAMLCYVTPKEHLGLPNRDDVREGVITYKIAAHAADLAK-GHPG-AQIRDD 496
gi 3024729   303 VLGPLVTDIAPGYDHITSAIGAAIAGWHGTAMLCYVTPKEHLGLPNAEDVRNGLIAYKIAAHAADIAR-HRPG-ARDRDD 380
gi 7388296   292 VLGPIVTDMAPGYDHISAAIGGAVAAMNGADFLCYVTPAEHLAIPGVQDVIEGVIASRIAAQAADAAR-KLPG-AWDSEL 369
gi 7388298   289 LLGPLVTDIAAGYDHIAAAIGAAIAGMAGADFICYVTPSEHLALPTVEDVREGVIAAKIAAHAIDLIKeGQRErARQRDY 368
gi 7388295   293 MLGPIVTDIGAGYDHIVSSIGAAASAAAGADFICYVTPAEHLALPYPDDVKEGVIATRIGAYVGDMVK-GIHN--GEKDL 369
gi 499172952 292 VLGPIVTDIAPGYDHITAAIGGALAGYYGADFLCYVTPSEHLRLPTIEDVKEGVIATKIAAQAADVAK-GNKl-AWEKET 369
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 417994    539 AMSKARFEFRWEDQFNLALDPFTARAYHDETLPQESGkvahFCSMCGpKFCSMKISQEVRD 599
gi 239938835 497 ALSKARFEFRWRDQFNLSLDPERALEYHDETLPAEGAktahFCSMCGpKFCSMRISQDIRD 557
gi 3024729   381 ELSKARYNFDWNRQFELSLDPERAKEYHDETLPADIYktaeFCSMCGpKFCPMQTKVDAEM 441
gi 7388296   370 EMADARRSFDWDKQFKLAFDSKKPYEYRMQCPIEDSE----MCSMCG-EYCALRILREDR- 424
gi 7388298   369 EMSLARKNLDWERQFELSIDPEKAREIYSRRKSESE-----ACSMCG-DLCAIKLVKEAFE 423
gi 7388295   370 EMANARKKLNWEAQFDAAMCPAEARRIRDERPPEDPD----TCTMCG-EYCAVKIVNEWLD 425
gi 499172952 370 EMAYARKNHDWEKQFELAIDKEKARKMREEIPSKEEK----ACSICG-DYCALLMVEELGK 425
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap