1E9Y


Conserved Protein Domain Family
urease_beta

?
TIGR00192: urease_beta 
Click on image for an interactive view with Cn3D
urease, beta subunit
In a number of species, including B.subtilis, Synechocystis, and Haemophilus influenzae, urease subunits beta and gamma are encoded as separate polypeptides. In Helicobacter pylori UreA and in the fission yeast Schizosaccharomyces pombe, beta subunit-like sequence follows gamma subunit-like sequence in a single chain; the fission yeast protein contains additional C-terminal regions. [Central intermediary metabolism, Nitrogen metabolism]
Statistics
?
PSSM-Id: 129296
View PSSM: TIGR00192
Aligned: 5 rows
Threshold Bit Score: 180.407
Threshold Setting Gi: 2501625
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E9Y_A     106 LVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIAAGTAVRFEPGEEKSVE 185
gi 2501629   4 MIPGEIITPEGDIELNVGRSTCTINVANTGDRPIQVGSHYHFYEVNAALQFDRDLAKGMRLDIPAGTAVRFEPGDEKNVN 83
gi 137069  106 LVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVE 185
gi 2501625   1 MKPGAFQIAEGTITINEGREIREVTVKNTGSRSIQVGSHFHFAEANGALLFDRELAIGMRLDVPSGTSVRFEPGEQKTVS 80
gi 1174890   1 MIPGEYQLAEGDILANVGRKTVKIEVTNSGDRPIQVGSHYHFFETNNALKFDRTLARGMRLNVPSGNAVRFEPGEVKSVE 80
                       90       100
               ....*....|....*....|.
1E9Y_A     186 LIDIGGNRRIFGFNALVDRQA 206
gi 2501629  84 LVAYAGSREIYGFNGLVNGPL 104
gi 137069  186 LIDIGGNRRIFGFNALVDRQA 206
gi 2501625  81 LVEIRGRKTIRGLNGMADTFI 101
gi 1174890  81 LVAFGGNQIIYGFHNQIDGKL 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap