Conserved Protein Domain Family
PncC_domain

?
TIGR00199: PncC_domain 
amidohydrolase, PncC family
CinA is a DNA damage- or competence-inducible protein that is polycistronic with recA in a number of species. Several bacterial species have a protein consisting largely of the C-terminal domain of CinA but lacking the N-terminal domain, including nicotinamide mononucleotide (NMN) deamidase (3.5.1.42) proteins PncC in Shewanella oneidensis and ygaD in E. coli. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129303
View PSSM: TIGR00199
Aligned: 6 rows
Threshold Bit Score: 214.191
Threshold Setting Gi: 401539
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9789731   263 VGALLRERGETVAVAESCTGGGLGALLTDQPGSSDYFWGGVIAYYNQVKIKLLGVDPEIIEYCGAVSEATAEAMALGVKE 342
gi 401539     24 LSQRLIADQLRLTTAESCTGGKLASALCAAEDTPKFYGAGFVTFTDQAKMKILSVSQQSLERYSAVSEKVAAEMATGAIE 103
gi 731549     13 VGQALKARGATVTTAESCTGGWVAKVITDIAGSSAWFERGFVTYSNEAKAQMIGVREETLAQHGAVSEPVVVEMAIGALK 92
gi 239938913 267 LSIACKEKGITISAAESFTGGLFSEWLTDHSGASKLFAGGVVCYTNDVKQNVLGVKKETLDRFGAVSKECASELAKGVQK 346
gi 6226730     6 IAEKLQKLQLSVATAESVTGGLLAHCLTSIDGASNYFNGGVIAYNNQVKINLLNVQSSTIANHGAVSSFCAREMAVGVKQ 85
gi 446591910  70 LIERLKSLDLKIAVAESCSGGLLSHAFTSISGASAVFMGGIVCYNEEVKRELLKVNATTLKVFGVYSEECVKEMLLGVFL 149
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 9789731   343 RLGTDWGIAITGIAGPGGGTEEKPIGTVYVGLADpHGQASHILLQFGDRrgREWIRYLSACQALDHLrrrL 413
gi 401539    104 RADADVSIAITGYGGPEGGEDGTPAGTVWFAWHI-KGQNYTAVMHFAGD--CETVLALAVRFALAQL---L 168
gi 731549     93 AARADYAVSISGIAGPDGGSEEKPVGTVWFAFATaRGEGITRRECFSGD--RDAVRRQATAYALQTL---W 158
gi 239938913 347 LTGSDIGISFTGVAGPDAQEGHEPGHV--FIGISaNGKEEVHEFHFAGS--RTGIRKRGAKYGCHLI---L 410
gi 6226730    86 KFQADVGIACSGIAGSKAVENKAIGLLFFCIIIGnKAYDFEFEMNQNNRkdNIELFTNKILESFHYLltkL 156
gi 446591910 150 NFKVDLALAMSGVAGPNGGNKANPVGTIYIGAQKlGSQALIDRCFFEGN--RESIQNKSVEHALNMLarmL 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap