Conserved Protein Domain Family
cydB

?
TIGR00203: cydB 
cytochrome d oxidase, subunit II (cydB)
part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129307
View PSSM: TIGR00203
Aligned: 4 rows
Threshold Bit Score: 474.74
Threshold Setting Gi: 2829797
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118042    1 MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYA 80
gi 1169174   1 MIDYEFLRFIWWVLVIVLLIGFSVTDGFDMGVTALLPVIGKKEVERRIMINTIAPHWDGNQVWLLTAGGAIFAAWPIVYA 80
gi 2506316   1 MFDYETLRFIWWLLIGVILVVFMISDGFDMGIGCLLPLVARNDDERRIVINSVGAHWEGNQVWLILAGGALFAAWPRVYA 80
gi 2829797   1 ---MASLHDLWFILVAVLFVGFFFLEGFDFGVGMATRFLGHNELERRVLINTIGPFWDANEVWLLTGAGAIFAAFPNWYA 77
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118042   81 AAFSGFYVAMILVLASLFFRPVGFDYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGN 160
gi 1169174  81 VSFSGFYIALVLVLAALFLRPLGFEYRAKIDNPTWRSVWDWGLFAGGFVPALVFGVAFGNLLQGVPFHFNELTQVTYTGS 160
gi 2506316  81 AAFSGFYVAMILVLCSLFFRPLAFDYRGKIADARWRKMWDAGLVIGSLVPPVVFGIAFGNLLLGVPFAFTPQLRVEYLGS 160
gi 2829797  78 TMLSGYYIPFVIVLLALMGRGVAFEFRGKVDHLKWVKVWDWVVFFGSLIPPFVLGVLFTTLFRGMPIDADMNIHAHVS-- 155
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118042  161 FFQLLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWvMYGIDGYVVKStMDHYAA 240
gi 1169174 161 FFELLNPFALLCGVISLSMLVTHGANWLQMKTTEALRDRARTVSQIGSIVTLIAFVLAGVW-LYSKDGYVVTStIDHFAP 239
gi 2506316 161 FWQLLTPFPLLCGLLSLGMVILQGGVWLQLKTVGVIHLRSQLATKRAALLVMLCFLLAGYWlWVGIDGFVLLA-QDANGP 239
gi 2829797 156 --DYINVYSILGGVTVTLLCFQHGLMFITLRTIGDLQNRARKMAQKIMGVVFVAVLAFAALsAYQTDMFTRRG------- 226
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118042  241 SNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTILTARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTM 320
gi 1169174 240 SSPMNKEVAVETGAWFRNFNEMPILWIFPALAVVAALLNAAFSKANRCGFAFFFSALTMAGVIITAAVSMFPFVMPSSSH 319
gi 2506316 240 SNPLMKLVAVLPGAWMNNFVESPVLWIFPLLGFFCPLLTVMAIYRGRPGWGFLMASLMQFGVIFTAGITLFPFVMPSSVS 319
gi 2829797 227 ---------------------E-ITIPLAVLIVICFMLAAVFIRKKKDGWTFGMTGAGLALTVGMIFISLFPRVMVSSLH 284
                      330       340       350       360       370
               ....*....|....*....|....*....|....*....|....*....|....*....
gi 118042  321 MNASLTMWDATSSQLTLNVMTWVAVVLVPIILLYTAWCYWKMFGRITKEDIERNTHSLY 379
gi 1169174 320 PEQSLLMWDSTSSELTLTLMLIFAVVFVVIALAYTIWSYSKMFGRLDANFIDKNKHSLY 378
gi 2506316 320 PISSLTLWDSTSSQLTLSIMLVIVLIFLPIVLLYTLWSYYKMWGRMTTETLRRNENELY 378
gi 2829797 285 SAYDLTVANASSGDYSLKVMSIAALTLLPFVIGSQIWSYYVFRKRVS-----HKEPMTY 338
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap