Conserved Protein Domain Family
fliF

?
TIGR00206: fliF 
flagellar basal-body M-ring protein/flagellar hook-basal body protein (fliF)
Component of the M (cytoplasmic associated) ring, one of four rings (L,P,S,M) which make up the flagellar hook-basal body which is a major portion of the flagellar organelle. Although the basic structure of the flagella appears to be similar for all bacteria, additional rings and structures surrounding the basal body have been observed for some bacteria (eg Vibrio cholerae and Treponema pallidum). [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 129310
View PSSM: TIGR00206
Aligned: 4 rows
Threshold Bit Score: 666.202
Threshold Setting Gi: 120324
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915695     1 MSKFFTNFFvsAKGIFKKASTVQKIALGLIIFFVILALVFLIGFSTKSq-----SIALFGVEIKDQyLLDRISQRLDREN 75
gi 2506421     1 MNATAAQTK--SLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAP------DYRTLFSNLSDQ-DGGAIVSQLTQMN 71
gi 120324      1 MNRTLMQMKnkTSEFWKNRSKLQKILMVSALAAIIIIGIIISVFASNS------KMAPLYKDLSAE-EAGQIKEELDAKK 73
gi 446286895   1 MDLKVLLQR--IVDFFIKLNKKQKIALIAAGVLITALLVFLLLYPFKEkdytqgGYGVLFEGLDSS-DNALILQHLQQNQ 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915695    76 VKYFLSSDGRIYLDDEKLAKKMRAILVREELVPVHMDPWALFDIDR-WTITDFERSINLRRSITRAVEQHIVALDDVDAV 154
gi 2506421    72 IPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEK-FGISQFSEQVNYQRALEGELSRTIETIGPVKGA 150
gi 120324     74 VPNELSNGGTVISVPEDQVDSLKVQMAAEGLPKTGSIDYSFFGQNAgFGLTDNEFDMVKVKATQTELSNLINEMDGIKNS 153
gi 446286895  78 IPYKVSKDD-TILIPKDKVYEERITLASQGIPKTSKVGFEIFDTKD-FGATDFDQNIKLIRAIEGELSRTIESLNPILKA 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915695   155 SVNLVMPEKALFKES-QEPVKASVRITPRPGSDIITNRkkVEGLVKLIQYAIEGLESDNIAIVDNSGTILNDfSNLDgid 233
gi 2506421   151 RVHLAMPKPSLFVRE-QKSPSASVTVNLLPGRALDEGQ--ISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQ-SNTS--- 223
gi 120324    154 KVMINLPKDAVFVGEeQSAASASIVLQIQPGYTLDQSQ--INGLYHLVSKSVPNLKEDNIVIMDQNSTYYDK-SDSDags 230
gi 446286895 156 NVHIAIPKDSVFVAK-EVPPSASVMLKLKPDMKLSPTQ--ILGIKNLIAAAVPKLTIENVKIVNENGESIGE-GDILe-n 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915695   234 RIDLAEKERKLKLKYEAMLRGEIDSALSKVLSVDRfMIARVNVKLDTSKETTESKEYAPIELQsqdpkasyntrkvSDST 313
gi 2506421   224 GRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGN-IHAQVTAQLDFASKEQTEEQYRPNGDE-------------SHAA 289
gi 120324    231 YADSYSSQQGIKSQVEKDIQKHVQSLLGTMMGQDK-VVVSVTADIDFTKENRTEDIVEPVDKEn------------MEGI 297
gi 446286895 231 SKELALEQLHYKQNFENILENKIVNILAPIVGGKNkVVARVNAEFDFSQKKSTKETFDPNN------------------V 292
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915695   314 IISSQTQKKEYQGQGYSp-WGPPGQEGN----TP-PEYQDLSDITGKYNESQEIKN------VALNEKKSTSEKEPARIV 381
gi 2506421   290 LRSRQLNESEQSGSGYP--GGVPGALSNqpapANnAPISTPPANQNNRQQQASTTSnsgprsTQRNETSNYEVDRTIRHT 367
gi 120324    298 AVSAEKVSETYQGDGAAn-GGTAGTGEE--------DVTNYKADGENTESGNYEKN-------S-N-KINYEVNRIHKEI 359
gi 446286895 293 VRSEQNLEEKKEGASKKqvGGVPGVVSN----IG--PVQGLKDN---KEPEKYEKS-------Q-N-TTNYEVGKTISEI 354
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915695   382 GVSLGIFVDGIWNFVYDekgDFVIENGMrkreYKPMALEEIKNIEDVLQSSFEYKPERGDSITVRNISFDr----MNEFR 457
gi 2506421   368 KMNVGDVQRLSVAVVVN---YKTLPDGK----PLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPFN-----SSDES 435
gi 120324    360 AESPYKVRDLGIQVMVE------PPDAKn---TASLSTERQDDIQKILSTVVRTSLDK-DETQNQNLSDAd----INNKI 425
gi 446286895 355 KGEFGTLVRLNAAVVVDgkyKIALKDGVntleYEPLSDESLQKINALVKQAIGYNQNRGDDVAVSNFEFNpmapvIDNAT 434
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3915695   458 EIDENYFASERFKYFLFIASIVFSLLILVFTIFFAISRELERRRRLREEELAKQAHLRRQQALMDGGDDIGVDDVV---- 533
gi 2506421   436 GGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRAEAMKAVQQQAQAREEVEDAVEVRLSKDEQLQq--- 512
gi 120324    426 VVSVQPFDGKVNLDTNTEES--SGIPLWAYIVGGVLIAAIIVLIIMLIRKKRAQEDEFEEYEYEVPQEPINLPDIN---- 499
gi 446286895 435 LSEKIMHKTQKILGSFTPLIKYILVFIVLFIFYKKVIVPFSERMLEVVPDEDKEVKSMFEEMDEEEDELNKLGDLRkkve 514
                        570       580       590       600       610
                 ....*....|....*....|....*....|....*....|....*....|
gi 3915695   534 --GGIREGDE------LQSNAELLAR--EKP----EDVAKLIRTWLLKNA 569
gi 2506421   513 --RRANQRLGa-----EVMSQRIREMsdNDP----RVVALVIRQWINNDH 551
gi 120324    500 --EEENETAE------SVRRKQLEKMakDKP----EDFAKLLRSWLAED- 536
gi 446286895 515 dqLGLNASFSeeevryEIILEKIRGTlkERPdeiaMLFKLLIKDEISSDG 564
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap