1HXQ


Conserved Protein Domain Family
galT_1

?
TIGR00209: galT_1 
Click on image for an interactive view with Cn3D
galactose-1-phosphate uridylyltransferase, family 1
This enzyme is involved in glucose and galactose interconversion. This model describes one of two extremely distantly related branches of the model pfam01087. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 129313
View PSSM: TIGR00209
Aligned: 4 rows
Threshold Bit Score: 668.975
Threshold Setting Gi: 587574
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HXQ_B       1 MTQFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVLPAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFA 80
gi 2506454   1 MTQFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVLPAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFA 80
gi 1169825   2 TALFEPTEHPHRRYNPLIDQWVLVSPHRAKRPWQGQQEKVNEEQKPSYDPTCYLCPSNKRITGELNPDYRKPYVFKNDFS 81
gi 587574    3 AEEFDFSSHSHRRYNPLTDSWILVSPHRAKRPWLGQQEAAYKPTAPLYDPKCYLCPGNKRATGNLNPRYESTYIFPNDYA 82
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HXQ_B      81 ALMSDTPDAPESH-------DPLMRCQSARGTSRVICFSPDHSKTLPELSVAALTEIVKTWQEQTAELG-------KTYP 146
gi 2506454  81 ALMSDTPDAPESH-------DPLMRCQSARGTSRVICFSPDHSKTLPELSVAALTEIVKTWQEQTAELG-------KTYP 146
gi 1169825  82 ALLEDTPAPEKSS-------DPLFQSSQARGESRVICFSPDHSKTLPLLTALEIEEVIKVWQEQLRELG-------AKYQ 147
gi 587574   83 AVRLDQPILPQNDsnednlkNRLLKVQSVRGNCFVICFSPNHNLTIPQMKQSDLVHIVNSWQALTDDLSrearenhKPFK 162
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HXQ_B     147 WVQVFENKGAAMGCSNPHPHGQIWANSFLPNEAEREDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAVVPYW 226
gi 2506454 147 WVQVFENKGAAMGCSNPHPHGQIWANSFLPNEAEREDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAVVPYW 226
gi 1169825 148 WVQIFENKGAAMGCSNPHPHGQIWANSFLPNEVAREDRTQRDYLLKHGSVMLVDYVKRELALKERIVVETEHWIALVPYW 227
gi 587574  163 YVQIFENKGTAMGCSNLHPHGQAWCLESIPSEVSQELKSFDKYKREHNTDLFADYVKLESREKSRVVVENESFIVVVPYW 242
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HXQ_B     227 AAWPFETLLLPKAHVLRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWHGAPFN--GEENQHWQLHAHFYPPLL 304
gi 2506454 227 AAWPFETLLLPKAHVLRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWHGAPFN--GEENQHWQLHAHFYPPLL 304
gi 1169825 228 AIWPFETLLLPKTHVKRLTELSDEQSKDLAVILKKLTTKYDNLFETSFPYSMGFHAAPFN--GEDNEHWQLHAHFYPPLL 305
gi 587574  243 AIWPFETLVISKKKLASISQFNQMVKEDLASILKQLTIKYDNLFETSFPYSMGIHQAPLNatGDELSNSWFHMHFYPPLL 322
                      330       340       350       360
               ....*....|....*....|....*....|....*....|....
1HXQ_B     305 RSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVS-DIHFRESG 347
gi 2506454 305 RSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVS-DIHFRESG 347
gi 1169825 306 RSATVRKFMVGYEMLGENQRDLTAEQAAERLRALS-EVHYKERT 348
gi 587574  323 RSATVRKFLVGFELLGEPQRDLTSEQAAEKLRNLDgQIHYLQRL 366
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap