Conserved Protein Domain Family
gltS

?
TIGR00210: gltS 
sodium--glutamate symport carrier (gltS)
[Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129314
View PSSM: TIGR00210
Aligned: 4 rows
Threshold Bit Score: 555.157
Threshold Setting Gi: 399761
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169972     3 YTFSTYETLALASLVLLLGYFLVKRINVLKTFNIPEPVVGGFIVAIGLLIWHKIDGTSFNFDKNLQTTMMLVFFTSIGLS 82
gi 399761      2 FHLDTLATLVAATLTLLLGRKLVHSVSFLKKYTIPEPVAGGLLVALALLVLKKSMGWEVNFDMSLRDPLMLAFFATIGLN 81
gi 447078730   4 IKLDIYATLVCMVLVLLLGRYVISKVKFLRDYDIPEPVVGGVLVAFAIMLARQFYNFGLQFDSSLKDPLMLTFFITIGLS 83
gi 499174345   4 IQFNIRQTIIVAILVLYIGKYLTKKIKFLQSFNIPDAVSGGVLASLFFGLIYGIFRTEVAFNFPIRDAFLIIFFTCIGLS 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169972    83 ANFSRLIKGGKPLVVFLFIAALLIFGQNVIGIASSMALGIHPAYGLLAGSVTLTGGHGTGAAWADTFAHQ-FNLQGATEI 161
gi 399761     82 ANIASLRAGGRVVGIFLIVVVGLLVMQNAIGIGMASLLGLDPLMGLLAGSITLSGGHGTGAAWSKLFIER-YGFTNATEV 160
gi 447078730  84 ADFKSLQKGGKMLAVFLLAVAGFVVCQNAVGISTASLLGVNPLMGLLGGSIALVGGHGTSAAWANFFTQPpYNFSSSLEV 163
gi 499174345  84 SKLKVLLQGGKPLLILLATAVSFLVIQNFVGVGMASLLGQALPVGLLSGSISLSGGHGTAIAWSPVFYDN-HGIRNASEI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169972   162 AIACATFGLVFGGIIGGPVARFLLnRQKQGENP--ENDEVDd-IQEAFEHPTYKRKITARSLIETIAMISVCLLIGQYLD 238
gi 399761    161 AMACATFGLVLGGLIGGPVARYLV-KHSTTPNG--IPDDQE--VPTAFEKPDVGRMITSLVLIETIALIAICLTVGKIVA 235
gi 447078730 164 GMACATFGLVSGGIIGGPVAKYLIsKYKLEPKDtkEKDTLEgvVSKGFETPKEQRLITESSFVETLALIAIALLVGTFLS 243
gi 499174345 163 AIACATFGLVFGGIVGGPIAKFLIiRNKLEPDC----DTKD--LTIGIRRDQDNVQIDYNTMLHTILVIGVTIGLGYEIN 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169972   239 VQTKGTALQLPTFVWCLFTGVIVRN--ILTNIFRFQVAES-AIDVLGSVGLSIFLAIALMSLRLWELAGLAIDVLIVLAI 315
gi 399761    236 QLLAGTAFELPTFVCVLFVGVILSN--GLSIMGFYRVFER-AVSVLGNVSLSLFLAMALMGLKLWELASLALPMLAILVV 312
gi 447078730 244 HLVPK-SFTLPTFVWCLFVGVILRN--TLSFFKIHSVFDR-EVSVIGNVSLSLFLAYALMSVNLLELLKLAVPLAVILSV 319
gi 499174345 237 DLVAKLGLMLPAFVSCLLAGIVLTNtiPLAFKKFPWPAETpSLALISDVSLGLFLAISLMSLQLWTLADIGGVIALILLV 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169972   316 QVAFMAAFAIFITYRAMGKDYDAVVLSAGHCGFGLGATPTAIANMQAVTSRFGPSHKAFLIVPMVGAFFIDLINAALLKV 395
gi 399761    313 QTIFMALYAIFVTWRMMGKNYDAAVLAAGHCGFGLGATPTAIANMQAITERFGPSHMAFLVVPMVGAFFIDIVNALVIKL 392
gi 447078730 320 QVVFMILYVVLVTFRVCGKDYDAAVLCAGHCGFGLGATPTAMVNMQTITNHYGPSHVAFIVVPLVGAFFVDIINALAIKG 399
gi 499174345 317 QFMATVLYSIAVVFPLMGRDYNAAVVCSGYSGLTLGATPTAIANMTAVTEKFGAAPQAFIVVPLVGAFFIDIANAFVIQQ 396

                 ....*.
gi 1169972   396 SFAVVN 401
gi 399761    393 YLMLPI 398
gi 447078730 400 FLLLPF 405
gi 499174345 397 FLNFLG 402
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap