2GMW


Conserved Protein Domain Family
GmhB_yaeD

?
TIGR00213: GmhB_yaeD 
Click on image for an interactive view with Cn3D
D,D-heptose 1,7-bisphosphate phosphatase
This family of proteins formerly designated yaeD resembles the histidinol phosphatase domain of the bifunctional protein HisB. The member from E. coli has been characterized as D,D-heptose 1,7-bisphosphate phosphatase, GmhB, involved in inner core LPS assembly (). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129317
View PSSM: TIGR00213
Aligned: 4 rows
Threshold Bit Score: 298.761
Threshold Setting Gi: 15645479
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GMW_A        25 VPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSL-ADRD 103
gi 1175503     2 NKAIFLDRDGTLNIDYGYVHEIDNFKFIDGVIDALRELKKMGYMLVLVTNQSGIARGYFSEDQFLQLTEWMDWSL-AEQD 80
gi 447018131   4 NKALFLDRDGIINIDKGYVSQKEDFEFQKGIFELLKHAKSLGYKLLLITNQSGINRGYYTLKDFEQLTQYLQESLfKELG 83
gi 401470      5 VPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSL-ADRD 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GMW_A       104 VDLDGIYYCPHHPQGsVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP 183
gi 1175503    81 VDLDGIYYCPHHSEG-KGEYKEDCDCRKPKSGMLLQAIKELKIDPTQSIMVGDKVEDLKAGIGAKVKMNVLVRTGKPVTG 159
gi 447018131  84 FNLDGIYFCRHAPEE-------NCACRKPKPSLILQAAKEHQICLEQSFMIGDKESDMLAGLNAKVKNNLLLIQNPLKTP 156
gi 401470     84 VDLDGIYYCPHHPQGsVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP 163
                        170
                 ....*....|....*...
2GMW_A       184 EAENAADWVLNSLADLPQ 201
gi 1175503   160 EGEGIADYVLDSIVDLPR 177
gi 447018131 157 HS-WIQCKDFKEMIDLIK 173
gi 401470    164 EAENAADWVLNSLADLPQ 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap