1PT0


Conserved Protein Domain Family
panD

?
TIGR00223: panD 
Click on image for an interactive view with Cn3D
L-aspartate-alpha-decarboxylase
Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pantothenate and coenzyme A]
Statistics
?
PSSM-Id: 129327
View PSSM: TIGR00223
Aligned: 4 rows
Threshold Bit Score: 184.733
Threshold Setting Gi: 2498745
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1PT0_A      18 MIRTMLQGKLHRVKVTHADLHYEGSaCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAE-RGSRIISVNGAAAHC 96
gi 1709570   1 MYRTMMSGKLHRATVTEANLNYVGS-ITIDEDLIDAVGMLPNEKVQIVNNNNGARLETYIIPGK-RGSGVICLNGAAARL 78
gi 2498745   1 MTFEMLYSKIHRATITDANLNYIGS-ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKkRGE--ICVNGAAARK 77
gi 400729    1 MIRTMLQGKLHRVKVTHADLHYEGS-CAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAE-RGSRIISVNGAAAHC 78
                       90       100       110       120
               ....*....|....*....|....*....|....*....|....*...
1PT0_A      97 ASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA 144
gi 1709570  79 VQEGDKVIIISYKMMSDQEAASHEPKVAVLNDQNKIEQMLGNEPARTI 126
gi 2498745  78 VAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKG-------- 117
gi 400729   79 ASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap