Conserved Protein Domain Family
CoA_E_activ

?
TIGR00241: CoA_E_activ 
CoA-substrate-specific enzyme activase, putative
This domain is found in a set of closely related proteins including the (R)-2-hydroxyglutaryl-CoA dehydratase activase of Acidaminococcus fermentans, in longer proteins from M. jannaschii and M. thermoautotrophicum that share an additional N-terminal domain, in a protein described as a subunit of the benzoyl-CoA reductase of Rhodopseudomonas palustris, and in two repeats of an uncharacterized protein of Aquifex aeolicus.This domain may be involved in generating or regenerating the active sites of enzymes related to (R)-2-hydroxyglutaryl-CoA dehydratase and benzoyl-CoA reductase.
Statistics
?
PSSM-Id: 129344
View PSSM: TIGR00241
Aligned: 5 rows
Threshold Bit Score: 347.549
Threshold Setting Gi: 2495734
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495734     1 MILGIDVGSTTTKMVLMEDSKIIWYKIEDIGVVIEED---ILLKMVKEIEQ-KYPIDKIVATGYGRHKVS---FADKIVP 73
gi 2496126   149 ISLGIDSGSTTTKAVVMIDDEVAGTGWIYTKDVIESAk-eAVNNALKEAGIsLDQVETIGTTGYGRYTVGeyfKADLIQE 227
gi 519083183   3 YSIGIDSGSTATKGILLADG-VITRRFLVPTPFRPAT---AITEAWETLREgLETTPFLTLTGYGRQLVD---FADKQVT 75
gi 499181911   2 IAAGIDIGSLTAKCALMRDGKLIAYKVIKVSPNLEETaerVFQETLKAAGIgREEVERIVATGYGRNKVG---FADKKVT 78
gi 499179931 146 LTLGIDSGSTTTKVVLMEDNEVIGTGWLPTTDVIGSAe-kGIEEALSGTGYkLEDIDGMGVTGYGRLTIGkhyGADLIQE 224
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495734    74 EVIALGKGANYFFNEADG---VIDIGGQDTKVLKIDkN-GKVVDFILSDKCAAGTGKFLEKALDILKIDKNEINKYKS-- 147
gi 2496126   228 ELTVNSKGAAYLADKQEGeatVIDIGGMDNKAISLY-D-AIPDGFTMGGICAGASGRFFEITARRLGVSLQELGELAAkg 305
gi 519083183  76 EISCHGLGARFLAPATRA---VIDIGGQDSKVIQLD-DdGNLCDFLMNDKCAAGTGRFLEVISRTLGTSVEQLDSITEn- 150
gi 499181911  79 EISCHARGAIYFIPTART---VVDIGGQDSKVIAIE-N-GKVAEFVMNDKCAAGTGRFLEVMAAALNLKVEELGDVAEr- 152
gi 499179931 225 ELSVNSKGAVFLADHQKGeatVLDIGGMDNKVITVN-D-GIPDNFTMGGICAGASGRFLEITARRLGVEIDELGSLALkg 302
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495734   148 -DNIAKISSMCAVFAESEIISLLSKKVPKEGILMGVYESIINRVIP-MTNRLKIQ-NIVFSGGVAKNKVLVEMFEKKL-N 223
gi 2496126   306 dWRKIKMNSYCIVFGIQDLVTALAEGAKAEDVAAAAAHSVAEQVFEqQLQEVDVRdPVILVGGSSLLKGLVIAMEEVL-G 384
gi 519083183 151 -VTPHAITSMCTVFAESEAISLRSAGVAPEAILAGVINAMARRSAN-FIARLSCEaPILFTGGVSHCQKFARMLESHL-R 227
gi 499181911 153 aTKATKISSTCTVFAESEVISHLASGEKVEDIVAGIHEAIASRIAA-MARRVKIEpDIVLTGGVAKNKAMKKALEKEF-G 230
gi 499179931 303 tYRKALLNSYCIVFGIQDLVTALAAGTSREDAAAAACHSVAEQVYEqQLQEIDVRePLIQVGGTSLIEGLVKAVSDILgG 382
                        250       260
                 ....*....|....*....|
gi 2495734   224 KKLLIPKEPQIVCCVGAILV 243
gi 2496126   385 RKIIVPRYSQLIGAVGAALL 404
gi 519083183 228 MPVNTHPDAQFAGAIGAAVI 247
gi 499181911 231 MEVKTPPEPQIVGAVGAALL 250
gi 499179931 383 IDVIVPPYSQHIGAVGAALL 402
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap