1NS5,1TO0


Conserved Protein Domain Family
tRNA_RlmH_YbeA

?
TIGR00246: tRNA_RlmH_YbeA 
Click on image for an interactive view with Cn3D
rRNA large subunit m3Psi methyltransferase RlmH
This protein, in the SPOUT methyltransferase family, previously designated YbeA in E. coli, was shown to be responsible for a further modification, a methylation, to a pseudouridine base in ribosomal large subunit RNA. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129349
View PSSM: TIGR00246
Aligned: 5 rows
Threshold Bit Score: 235.974
Threshold Setting Gi: 51247684
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NS5_A         2 KLQLVAVGTKXPDWVQTGFTEYLRRFPKDXPFELIEIPAGKRGKNA---DIKRILDKEGEQXLAAAG-KNRIVTLDIPGK 77
gi 1175560     2 KITLIAVGTKMPSWVTTGFEEYQRRFPKDMPFELIEIPAGKRGKNA---DIKRILEQEGKAMLAACG-KGKVVTLDIPGK 77
gi 489335941   2 NINIVTIGKLKEKYLKQGIEEYTKRLSAYAKIDIIELPDEKAPENLsdqDMKIIKDKEGDRILSKISpDAHVIALAIEGK 81
gi 140260      2 KLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNA---DIKRILDKEGEQMLAAAG-KNRIVTLDIPGK 77
1TO0_A         2 NINIVTIGKLKEKYLKQGIEEYTKRLSAYAKIDIIELPDEKAPENLsdqDXKIIKDKEGDRILSKISpDAHVIALAIEGK 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
1NS5_A        78 PWDTPQLAAELERWKLDGRD-VSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHR 154
gi 1175560    78 PWTTPQLAEQLEAWKNDGRD-VCLLIGGPEGLSPECKAAAEQSWSLSPLTLPHPLVRVVVAESLYRAWSLTTNHPYHR 154
gi 489335941  82 MKTSEELADTIDKLATYGKSkVTFVIGGSLGLSDTVMKRADEKLSFSKMTFPHQLMRLILVEQIYRAFRINRGEPYHK 159
gi 140260     78 PWDTPQLAAELERWKLDGRD-VSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHR 154
1TO0_A        82 XKTSEELADTIDKLATYGKSkVTFVIGGSLGLSDTVXKRADEKLSFSKXTFPHQLXRLILVEQIYRAFRINRGEPYHK 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap