1JRM,1N91


Conserved Protein Domain Family
TIGR00251

?
TIGR00251: TIGR00251 
Click on image for an interactive view with Cn3D
TIGR00251 family protein
[Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129353
View PSSM: TIGR00251
Aligned: 6 rows
Threshold Bit Score: 98.3486
Threshold Setting Gi: 29839698
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JRM_A         7 LREVGDDLLVNIEVSPASGKFGIPSYNEWRKRIEVKIHSPPQKGKANREIIKEFSETFGR---DVEIVSGQKSRQKTIRI 83
gi 29839449    7 LREVGDDLLVNIEVSPASGKFGIPSYNEWRKRIEVKIHSPPQKGKANREIIKEFSETFGR---DVEIVSGQKSRQKTIRI 83
gi 29839698    1 MREAKDGVLISVHVSPGS-KEVSFSYDEWRRAVEVRIKSPAKEGKANRELLGIFRQIFG----EVELVSGEKSRSKVLKG 75
gi 447199967   4 VTVNDDGLVLRLYIQPKASRDSIVGLHG--DEVKVAITAPPVDGQANSHLVKFLGKQFRVaksQVVIEKGELGRHKQIKI 81
gi 2496078     6 IKESREGVLIDIDVQANAKKNEIVGINEWRKRLSIKIKAPATEGKANKEIIKFFKEIFKK---DVEIVSGKLNPQKTVLI 82
1N91_A         8 VTVNDDGLVLRLYIQPKASRDSIVGLHG--DEVKVAITAPPVDGQANSHLVKFLGKQFRVaksQVVIEKGELGRHKQIKI 85
                         90
                 ....*....|.
1JRM_A        84 QGmGRDLFLKL 94
gi 29839449   84 QGmGRDLFLKL 94
gi 29839698   76 K---RE----- 78
gi 447199967  82 IN-PQQIPPEI 91
gi 2496078    83 GDiKKDEVIEI 93
1N91_A        86 IN-PQQIPPEV 95
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap