Conserved Protein Domain Family
TIGR00255

?
TIGR00255: TIGR00255 
TIGR00255 family protein
The apparent ortholog from Aquifex aeolicus as reported is split into two consecutive reading frames. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129357
View PSSM: TIGR00255
Aligned: 4 rows
Threshold Bit Score: 388.816
Threshold Setting Gi: 401581
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 401581      1 MIRSMTAYARREIKGEWGSATWEMRSVNQRYLETYFRLPEQFRSLEPVVRERIRSRLTRGKVECTLRYEPDVSAQGELIL 80
gi 1176307     1 MIYSMTAFARLEVKKDWGDAVWEIRSVNQRYLENFFRLPEQFRGLENTLREKLRQNLTRGKIECSLRIETKKQANAELNL 80
gi 497653031   1 MIRSMTGFGSASKTQDDLSVSVELKSVNYRFKEVNARLPRPLLYFEDKLKQTILQHIQRGRIELFVSVDSDMLVEKRLEI 80
gi 499192288   1 -MKSMTGFFYLEKIIGNYMFSVNLKSYNGKFLEFKFRLPEIFSGYDLDIRNLISKYISRG--NVFLNVGYKELVPSVNFT 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 401581     81 NEKLAKQLVTAANWVKMQ-S--DEGEINPVDILRWPGVMAAQEQDL--DAIAAEILAALDGTLDDFIVARETEGQALKAL 155
gi 1176307    81 NKELANQVIQSLQWIKAQ-A--GEGEINLTDVLRYPGVVEAQEQDL--DAISQDLLTAFDDLLTDFIAMRGREGEKLNDI 155
gi 497653031  81 DWPLLDEFVAAARDMKKRyQ--LSAEPDVMDFFKLDHVVQVHEEQTqnDKLEALIIDAAEEAVKGLCEMREKEGLLLAKD 158
gi 499192288  78 INPNYIEAISRLRDSLAHtNlnIKNELSLGDFLSLKGALIIDEDSEhqEEIYGLFKGVLEEALLHYNNGRSFEGENTKSD 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 401581    156 IEQRLEGVTAEVVKVRSHMPEILQWQRERLVAKLED-AQVQLENNRLEQELVLLAQRIDVAEELDRLEAHVKETYNILKK 234
gi 1176307   156 IQQRLDSIAVETDKVRSQMPAVLQWQRERLLQRFED-AQLNLDPQRVEQEMILLAQRIDVAEELDRLQMHVKETTNILKK 234
gi 497653031 159 CLMHIDQLEELVRETELLAADVVSRYRERLYARIKEwTEDVLDESRLVTECAIFADRSDITEEITRLKSHFAQFRDILAS 238
gi 499192288 158 IVSTLVLIERDLKIVKDACSDINVKLFASIKENISKlMDEFRDLN-IAEEAAKMAIRLDINEEIMRLDSHIETFYKNLEY 236
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
gi 401581    235 KEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMREQIQNIE 287
gi 1176307   235 GGAVGRKLDFMMQELNRESNTLASKSINADITASAVELKVLIEQMREQIQNLE 287
gi 497653031 239 GGAVGRKLDFLVQELNREANTIGSKANDHQITKLVVEMKSSIEKIKEQVQNIE 291
gi 499192288 237 -EICGKALEFISQEMHREITTMSNKAVDLDIKNLILNMKLNLEKIKEQIRNVE 288
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap