Conserved Protein Domain Family
thylakoid_BtpA

?
TIGR00259: thylakoid_BtpA 
membrane complex biogenesis protein, BtpA family
Members of this family are found in C. elegans, Synechocystis sp., E. coli, and several of the Archaea. Members in Cyanobacteria have been shown to play a role in protein complex biogenesis, and designated BtpA (biogenesis of thylakoid protein). Homologs in non-photosynthetic species, where thylakoid intracytoplasmic membranes are lacking, are likely to act elsewhere in membrane protein biogenesis. [Protein fate, Protein folding and stabilization]
Statistics
?
PSSM-Id: 129361
View PSSM: TIGR00259
Aligned: 4 rows
Threshold Bit Score: 352.961
Threshold Setting Gi: 3915360
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3913186  10 HNPVIGVVHLLPLPTSARWGGN--LTAVIERAEQEATALAAGGVDGIIVENFFDAPFPKqRVDPAVVSAMTLIVDRLQNL 87
gi 732071   11 EKAVIAMCHLRALPGDPSFDAQlgMNWVIDKAWDDLMALQNGGVDAVMFSNEFSLPYLT-KVRPETTAAMARIIGQLMSD 89
gi 3915360   2 EKTVIGVVHLLPLPGSPEHTD---LSAVIDKAVKDARAIEEGGADALILENYGDKPFLK-EVGKETVAAMTVIACEVKRD 77
gi 3915417   7 KKPLIGMVHLKPLPGSYHYNDN--FDDIVDFAIKEAKKLEEAGFDAVMIENFGDAPFKK-EADKITIASMAVIAKAIKEE 83
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3913186  88 VVAPVGINVLRnDAHSALAIASCVGAKFIRvNVLTGVMATDQGLIEGNAHELLRYRRELSS-DVAILADVLVKHARPLGT 166
gi 732071   90 IRIPFGVNVLW-DPVASFDLAMATGAKFIR-EIFTGAYASDFGVWDTNVGETIRHQHRIGAgEVKTLFNIVPEAAVYLGN 167
gi 3915360  78 VSIGLGINVLRnDAVAALAIAKAVNADFVRvNQLFFTSVSPEGILEGKAGEVMRYKKLVDC-RAMIFADIAVKHAVHF-- 154
gi 3915417  84 VSLPLGINILRnDAIGAYSIAYVVKADFIRvNVLSGVAFTDQGIIEGKAYELAKLKKLLPS-KIKVFADVHVKHAYHF-- 160
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3913186 167 PNLTTAVTDTIERGLADGIILSGWATGSPPNLEDLELATNAAKGTPVFIGSGADEDNIGQLIQAANGVIVASSLKRHGNI 246
gi 732071  168 RDICSIAKSTVFNNHPDALCVSGLTAGTRTDSALLKRVKETVPDTVVLANTGVCLENVEEQLSIADGCVTATTFKKDGVF 247
gi 3915360 155 ASLEDYCLN-AERSLADAVILTGKTTGGEVSLEELKYAKKTLK-MPVLAGSGVNAENAARILKWCDGVIVGTYIKRGG-- 230
gi 3915417 161 IDFESSLLDTVERGLADAVIISGKRTGKEVDIEKLKLAKELVD-VPVIVGSGTNYNNLRILWSYADGFIIGTWIKKDGKA 239
                      250       260
               ....*....|....*....|.
gi 3913186 247 NEAIDPIRVSAFIEAMAEGLK 267
gi 732071  248 ANFVDQARVSQFMEKVHHIRR 268
gi 3915360 231 --LVDAERVRRIVR-AAKG-- 246
gi 3915417 240 NNEIDIDRAKKIVN-LANKLK 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap