Conserved Protein Domain Family
TIGR00269

?
TIGR00269: TIGR00269 
TIGR00269 family protein
[Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129370
View PSSM: TIGR00269
Aligned: 4 rows
Threshold Bit Score: 161.902
Threshold Setting Gi: 2501587
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2501587   237 VKRIKPLKLIPEEEVKLYAEINNIKYQREPCPYSSLSYRHRMKKVIEILEEEKPGVKFSILRGYEK----LLKYLNVKEE 312
gi 499181552 197 VVRIKPFRYVYEKEVVVYGFLHELPMDFDECPYSHFPVRAAVRDFLYDFENKYPGRKFSVMSSFEKli-pCLKEIYPQID 275
gi 499179270 176 VPRIKPLWSTPESEVRLWAVLNDVKVHLDSCPYSDLSMRSRIRDFLNHLESEKQGVKLRVMESLSR----TFLPLSETEG 251
gi 499179808 163 IPKIKPLREIPEKEVALYVLARGLDVHLAGCPYASGSFRREIGDFLKQISVKRPTIMYSTLRGFDRikeiLRRDLSESGR 242
                         90       100
                 ....*....|....*....|....*
gi 2501587   313 IRRCEICGFPCSGNICKVCSWLIKL 337
gi 499181552 276 LNRCERCGEPTPRRICQACKLLEEL 300
gi 499179270 252 LRECLRCGEPSSGDKCKACEFLELI 276
gi 499179808 243 SGICVKCGEPASGKLCKACTFIEEL 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap