Conserved Protein Domain Family
TIGR00270

?
TIGR00270: TIGR00270 
TIGR00270 family protein
[Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129371
View PSSM: TIGR00270
Aligned: 3 rows
Threshold Bit Score: 177.411
Threshold Setting Gi: 11499559
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2496059     7 QMCELCG-KLTDKLYKVIIEGSEMNVCKECAKFGKspktysrlgkktIIGKGTITTNKQVKKPIKRRRD---IFDTLPML 82
gi 499178828   1 MRCEICGkKIVGKPLKTKIDSSVMEVCRECSKFGK------------IIREPTTPRKKSFRKPQKRSRR---PMDTVYEV 65
gi 668356897   1 MNCEICGrEIKGKGFKIVVEGSEVTVCGSCRQFGTe-------------KKPSVASQQGARRVVLKKKRgstKIEFTEEL 67
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2496059    83 REDYGDVIREAREKRGLSIEELAKKLKMKASTLQKFERYELEPNEKEIKILEKELKISLTESIGEETSYYG-GRDEDGFT 161
gi 499178828  66 VEDYGRIIRTEREKRDWSREDLAERINEKVSVINRIESERMEPDIKLARKLERLLKIKLLEKFEADDLEKSeGGGFRGAT 145
gi 668356897  68 VENFHIIIRREREKRGWSQEQLAKKIQEKESLIKKIENAEITPEPEVVEKLEKLFNIKLREQVPEIKIEKS---KSLVPT 144

                 ....*....
gi 2496059   162 LGDFIKIKK 170
gi 499178828 146 IGDIARIKR 154
gi 668356897 145 LGDvvvvkr 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap