Conserved Protein Domain Family
TIGR00271

?
TIGR00271: TIGR00271 
uncharacterized hydrophobic domain
This domain is in a family of archaeal proteins that includes AF0785 of Archaeoglobus fulgidus and in several eubacterial proteins, including the much longer protein sll1151 from Synechocystis PCC6803.
Statistics
?
PSSM-Id: 129372
View PSSM: TIGR00271
Aligned: 6 rows
Threshold Bit Score: 169.487
Threshold Setting Gi: 416205
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416205      1 STLSVTYLSFMTLATTLAACGVVLDNAVLIVGAMAIGPDFGPLAGVSVAMVERRHRLVARCLICLLVgfavAIAVTVLFS 80
gi 3449249   112 STLSITYVAFITLATMIAACGVVLDNAVLIVGAMAVGPEFGPLAGICTAIVQRAPRLALRSATALLVgfavAMAVTVGFS 191
gi 2833525   105 ANLSKENMLMLILSTIVAIAGIYKDDVALLIASMIIAPLLGPNIALSLSITVADYKLALKSIKTLIA----ELIFVIILS 180
gi 2842592   113 VKITKNVIIKVILASIMGVIGLIEHNIPTLIGAMIIAPLVDTVMGSAIGTVLGDKELFIQGMKKELL----CSGIVIVCA 188
gi 499174885  46 SLRDISYWIEVLFAAGIATLGLVLNSPAVIIGAMLISPLMGPILANGMGLAAGDVVLWLRAAFNLLL----SCSLAIVFA 121
gi 499180748 124 ASLNPGRSVVTAIAGVIALSGLIMNNAVIVIGAMLLAPLLGPIHGFAVNLSVGYVKLAFRSALNLLFdlflTMVFSTLFA 203
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416205     81 LAMdaaGLFHAEQLTRhrPITEFIVSPDEFSLIVGVLAGVAGTLSLT---SAKSGALVGVAISVTTIPAAANAAVALSYG 157
gi 3449249   192 WIMtefGQFSEGKLEGerPNTGFVYAPDAFSFVVAVLAGIAGTLSLT---SAKSGALVGVAISVTTVPAAANAAVALSFG 268
gi 2833525   181 MIA---GHYLPISLDN--PQIHSRITLDFWSIIIALSAGIAGSLSTV---SNISSIAVGVMIAIALLPPLAVFGLLIGAG 252
gi 2842592   189 FIP---SLFFVSKELV--LQYLSETSII-LSAIVAIIAGISGGMSIA---SGKEYEIIGVTIDVSILIPALLMGMALATM 259
gi 499174885 122 AIL---VVIVPFKEIT--PEILARTNPTLLDLIVALFSGAVGSVATCkqaKGVAASLPGVAIAVALMPPLCVVGYGIGIY 196
gi 499180748 204 MMI---GLVHPLQLT---PEILLRTEVSPVYELLAVLLGFASILSLS---RGILESLAGVAVSASLLPPAVATGILLVIS 274
                        170       180       190
                 ....*....|....*....|....*....|....
gi 416205    158 NYAQTRASSE-------QLLLNLVAISVAGTLTL 184
gi 3449249   269 DTNQTVGSTE-------QLLLNLAGIVVAGTLTL 295
gi 2833525   253 YVEQSFSALI-------LFLINMIAINLSAIVIF 279
gi 2842592   260 DLYLIYITFI-------LLAINIVLLDVGGYIGL 286
gi 499174885 197 FSLASSQGLTvakggglLFITNLVAIIFTAMIVF 230
gi 499180748 275 PPLAVKS-LT-------LTLQNVAGLMAGSLAGV 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap