Conserved Protein Domain Family
TIGR00273

?
TIGR00273: TIGR00273 
iron-sulfur cluster-binding protein
Members of this family have a perfect 4Fe-4S binding motif C-x(2)-C-x(2)-C-x(3)-CP followed by either a perfect or imperfect (the first Cys replaced by Ser) second copy. Members probably bind two 4fe-4S iron-sulfur clusters. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129374
View PSSM: TIGR00273
Aligned: 4 rows
Threshold Bit Score: 564.109
Threshold Setting Gi: 11498417
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494447    18 IEDPIMRKAVANAQQRIGANRQ-KMVDELGHWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFARTKEDATRY 96
gi 489320979  18 IDNEFMRGAVSGAQERLRTRRL-EAAEELGNWEEWRSLSEEIRQHVLENLDFYLGQLAENVAKRGGHVYFAKTAEEASSY 96
gi 446339449  18 LGDMQLRENLRSAMDTLRANRKnLLKNRYSEWENLRELGKEVKLKILSRLDEYLELFEKNATQNGFKIHYAKDGDEANEI 97
gi 499180774  12 IKEGILR-SLRNLSENVRRN-----VENHPYLIDFAEDVKSAKLKVAENYDFWIDKAKDVLESRGVNVYYAESAEEARKI 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494447    97 ILQVAQRKNARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLD-QDPPSHVVVPAIHKDRHQIRRVLHERLGY 175
gi 489320979  97 IRDVIQKKNGKKIVKSKSMVTEEINLNEVLEKEGCEVVETDLGEYILQIDdHDPPSHIVAPALHKNKEQIRDVFKERLDY 176
gi 446339449  98 IYNLAKEKNIKRILKQKSMASEEIGLNHYLKEKGIQAQETDLGELIIQLI-NEHPVHIVVPAIHKNRKQIGKIFEEKLNA 176
gi 499180774  86 AGKVVGE--GKLVVKAKSMVSEEIHLREWLEKIGNEVWETDLGELIVQVA-GDKPMHMVIPALHYSEQEVGEILK-RIGV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494447   176 EGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNEGNARMCTTLPKTHIAVMGMERIAPTFAEVDVLI 255
gi 489320979 177 QHTEKPEELVMHARAILRKKFLEADIGITGCNFAIADTGSVSLVTNEGNGRLVSTLPKTQITVMGMERIVPSFSEFEVLV 256
gi 446339449 177 AYEEEPEKLNAIARKHMRKEFESFKMGISGVNFAIANEGAIWLVENEGNGRMSTTACDVHVAICGIEKLVESFDDAAILN 256
gi 499180774 162 EG-ESAEVLAREVRKFMREKFLKADVGVSGCNAFSAETGRIFLIENEGNIRLSTSLPKTYLALVSIEKILPT--DELCLK 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494447   256 TMLARSA-VGARLTGYNTWLTGPREAGHVDGPEEFHLVIVDNGRSEVLASE-FRDVLRCIRCGACMNTCPAYRHIGGHGY 333
gi 489320979 257 SMLTRSA-VGQRLTSYITALTGPKLEGEVDGPEEFHLVIVDNGRSNILGTE-FQSVLQCIRCAACINVCPVYRHVGGHSY 334
gi 446339449 257 NLLAPSA-VGVPITCYQNIITGPRKEGDLDGPKEAHIILLDNNRSNILADEkYYRALSCIRCGTCLNHCPVYDKIGGHAY 335
gi 499180774 239 SICVQSAfFGTFPPAYINVNEKVQQQ---D----MHVILLDNGR-K--NTQ-FREQLACVRCGRCQLECPVFQLAGNVWG 307
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494447   334 GSIYPGPIGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEK-GI----------TAKAEQRA 402
gi 489320979 335 GSIYSGPIGAVLSPLLGGYDDYKELPYASSLCAACSEACPVKIPLHELLLKHRQNIVEKeGR----------APISEKLA 404
gi 446339449 336 LSTYPGPIGVVVSPQLFGLNNYGHIPNLCSLCGRCTEVCPVEIPLAELIRDLRSDKVGE-GRgvikgakstqHSGMEKFS 414
gi 499180774 308 GEVYGGPMGMIWSAITDAITDY---CFLSTLCGKCREVCPMKIDMPRMIREIR------------------------KLA 360
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|..
gi 2494447   403 IKMFAYANSHPGLWKVGMMAGahaaSWFINGGKTPLKFGA-ISDWMEARDLP 453
gi 489320979 405 MKAFGLGASSLSLYKMGSKWApaamTPFTEDEKISKGPGP-LKNWTQIRDFP 455
gi 446339449 415 MKMFAKMASDGAKWRFQLKMA----QFFSPLGKLLAPILPlVKEWASVRTLP 462
gi 499180774 361 LKLD------------------------------------------------ 364
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap