1P9Q,2WBM


Conserved Protein Domain Family
RNA_SBDS

?
TIGR00291: RNA_SBDS 
Click on image for an interactive view with Cn3D
rRNA metabolism protein, SBDS family
This protein family, possibly universal in both archaea and eukaryotes, appears to be involved in (ribosomal) RNA metabolism. Mutations in the human ortholog are associated with Shwachman-Bodian-Diamond syndrome. [Protein synthesis, Other]
Statistics
?
PSSM-Id: 129392
View PSSM: TIGR00291
Aligned: 6 rows
Threshold Bit Score: 332.57
Threshold Setting Gi: 2501598
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P9Q_C      23 MVSLDKAVIARLRKGGEEFEVLVDPYLARDLK-EGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKI 101
gi 6647937   1 MVSLDKAVIARLRKGGEEFEVLVDPYLARDLK-EGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKI 79
gi 2501600   6 MVSLEEAVIARYTSHGEKFEILVDPYLAAKLK-EGQNVDFDELLAIEVVFRDASKGEKAPEELLSKIFGTTDVKEIAKKI 84
gi 6647980   1 MVSLEDAVIARLESHGERFEVLVDPDLAAEFRrEDSDVSVEDVLAVQEVFRDARKGDKASEEAMRKVFETADPLEVTPVI 80
gi 2501598   9 QIKLTNVSLVRLKKARKRFEVACYQNKVQDYR-KGIEKDLDEVLQIHQVFMNVSKGLVANKEDLQKCFGTTNVDDVIEEI 87
2WBM_A      21 MVSLEDAVIARLESHGERFEVLVDPDLAAEFRrEDSDVSVEDVLAVQEVFRDARKGDKASEEAMRKVFETADPLEVTPVI 100
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P9Q_C     102 ILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPRTNAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALK--PIL 179
gi 6647937  80 ILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPRTNAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALK--PIL 157
gi 2501600  85 ILKGQVQLTAKQREEIREQKKRQIITIISRNTINPQTDTPHPPHRIEKAMEELRINIDIYKSAEEQVPEIVKKLK--KVL 162
gi 6647980  81 LRRGTIQLTAEQRRQMIEDKRLKIINKIAREAINPQNGLPHPPKRIEKAMEEARVHVDPFKTVDEQVNIVLKAIR--TKI 158
gi 2501598  88 MHKGEIQLSEKERQLMLNKVNNEMLTIVSAKCINPVSKKRYPPTMIHKALQELKFSPVINKPAKLQALEAIKLLVskQII 167
2WBM_A     101 LRRGTIQLTAEQRRQMIEDKRLKIINKIAREAINPQNGLPHPPKRIEKAMEEARVHVDPFKTVDEQVNIVLKAIR--TKI 178
                      170       180       190       200       210       220       230
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
1P9Q_C     180 PLKFEEMEIAIKIP-PEHTGRAISALYNFGGVTREE--WQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLR 253
gi 6647937 158 PLKFEEMEIAIKIP-PEHTGRAISALYNFGGVTREE--WQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLR 231
gi 2501600 163 PIRFEKRDIAVKIP-AEFASKAYNALYQFGAVKQEE--WQPDGSLIVLIEIPSGIEAEFYAHLNKITKGNVQTKVVK 236
gi 6647980 159 PIKFEKVRVAIKIP-GERAGSAYGVISNFGKITNEE--WQNDGSWIAVVEIPGGLQDSFYQKLSELTGGNVETRLIK 232
gi 2501598 168 PIVRAKMKVKVAISePSRQPELIEKISKLIASSPGEstKPELDPWTCTGLIDPVNYRDLMTLCDKKGTVQVLDMAVI 244
2WBM_A     179 PIKFEKVRVAIKIP-GEMAGSAYGVISNFGKITNEE--WQNDGSWIAVVEIPGGLQDSFYQKLSELTGGNVETRLIK 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap