Conserved Protein Domain Family
TIGR00294

?
TIGR00294: TIGR00294 
GTP cyclohydrolase, MptA/FolE2 family
This family includes type I GTP cyclohydrolases involved in methanopterin in archaea (MptA) and de novo tetrahydrofolate biosynthesis in bacteria (FolE2). [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 129395
View PSSM: TIGR00294
Aligned: 4 rows
Threshold Bit Score: 419.265
Threshold Setting Gi: 1805406
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229462918   6 DVQNFEPDVKISLTRVG-VTNLKKLVRLKRTNKRPIILLSTFEVFVNLPSSQKGIHMSRNPEVIEGIIDEALELESYEME 84
gi 499179280   8 DTQDKIPSIPVHLTRVG-VTGVKKLLKIEREGRRPIILLPTFDAFVDLPSKQRGIHMSRNPEAISDVLEEVVENNALELE 86
gi 499181135   4 DVQLLKPEVPIGLSRVG-ATGIKKLVEVQREGKRPIILISTFDVFVDLPAHLKGVNLSRNFEVIDEVLETLTAKPIENIE 82
gi 1805406     2 NQHTLLPKKTERLQYFGsVSPIKGEKPVEKEKMKDLQNIR-KDYFFDIQ--HVGVANVSHPVTITSAMMPAEQTTAANFT 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229462918  85 TICEEIVKR-LFEKHEYATEAEVFMVSDFMTKEKSPISGKYSQEIHKIMGGAKGIKKDDE--IELTKIVGAEVVGITACP 161
gi 499179280  87 SLCAEIVNE-LLKKHRYARRAEVSMNSDFMFMKRSPVTRRKSQEMTKIMADAIGYRDDDG--IVIRKMIGAEVVGMTVCP 163
gi 499181135  83 DLVVEIADH-LLKRHEYATKAEARMNSELIMRKRTPKTGQRTQEVVKIFGEATLGRDGS-----KVIMVGVEVTGITACP 156
gi 1805406    79 MTCNLPRNQkGINMSRLTELLQVYHQNGWILSFSS--LQQFTKELAENMDTSSATVEVRFpwFFERKSPKLEKAGLMHAD 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229462918 162 CAQNLIKEICIKNLKEKgFSDED---IDKILDSVIFATHNQRG----IGRIILEVPTGYDIEIMDIIEIIKKSMSAEIHG 234
gi 499179280 164 CAQESVREASRQKLLEF-LDDET---VERVLDCVSFASHNQSG----RGMIMIEVPEDQTIRAEKLIDIIESSMSSPVYE 235
gi 499181135 157 CAQELVKASSAERLAKMgFDEET---IQKILDAIPVATHNQRG----RATLKVQVTDSFKVPIAKLIDVAKSSMSYETYE 229
gi 1805406   157 IFMSVTYRKDQPFKQRAgISAKVttlCPCSKEISEYSAHNQRGtvkhLGRIFTRAASLPSDVKADLPHAAESNASARLHP 236
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 229462918 235 ILKRADEAYVVEQSHKNPKFVEDCVREMAKRVVEKFKHLPDETKVLIRQINMESIHRHDAFAEKVATLGELRRELLSYE 313
gi 499179280 236 LLKRPDENAVVMSAHENPMFVEDCVRNMVHRIVSEYPHLPDDTIVTVRQINEESIHRHNAFAEKVATMGELRYEIEELN 314
gi 499181135 230 ILKREDELAVVEAAHRNTRFVEDGVRYMAMELLKTFPNAPDDILVFLRQENEESIHQHNVVAERFATFGELRNEIGSPD 308
gi 1805406   237 VLKRPDEKAVTETAYENPRFVEDLARLIAADLFELEWVS--AFEIECR--NEESIHLHRCLCE--VCFSKEVDKI---- 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap