Conserved Protein Domain Family
TIGR00299

?
TIGR00299: TIGR00299 
TIGR00299 family protein
Members of this family are found in the Archaea and in several different bacteria lineages. The function in unknown and the genomic context is not well conserved. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129400
View PSSM: TIGR00299
Aligned: 4 rows
Threshold Bit Score: 564.045
Threshold Setting Gi: 11499680
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499173776   4 IAYFDC-PTGISGDMCLGALVSAGVPLEYLMEKLAPLGLT-DEYRLTAGLVQKQGQAATKVEVKLLndhhshGPGHHGMR 81
gi 499179193   9 VTVIDPqLAGVSGNMMVGALIDLGAHPERTAEVMEDAASHfGGADVSVSEVKRAGLRATYVDVRAD------ESLSVGYL 82
gi 499173317   1 MFLLDP-FSGISGDMFLSAMIDF-VDKEDFINTIKKVID----VEIEIKKVKKCHILANKVNI-IP------KCINCNAN 67
gi 499182048   3 VAIFDA-FNGASGDMILASLLGVGISEEEIDEVVKALGID---VNYSMTTVSVRGISARRVEV----------EERDGER 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499173776  82 HLPEIEQLIKQANLPARVSRWSLAIFHQLAIAEGEVHGIEPEAVHFHEVGATDAIVDIVGTCLGLDYLG-IDQCYW-S-A 158
gi 499179193  83 EFLRLLEGISHPALDDEMLSMARAVFHTIAQAEASVHGVKLDEVHFHEVGAADAVADVMGAVFAYFDLNlHRDEVY-TlP 161
gi 499173317  68 TYKDIKNVIKSSDIQEDIKITALEILKILAEAESKVHNVDVENVHFHEVGNYDTIADIVGAAYIINKLNlKNNCLY-K-P 145
gi 499182048  69 SFKEVLEIIRSSNLEEGVKKNAIAVFELIARAEGKVHGRDYREGVFHEVGADDAIFDVVCCVKAFENLKtAGYEFFaT-P 147
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499173776 159 LPTGSGTVRAAHGDLPVPVPAVLKLWQTrqVPVYDNGLTGELVTPTGAAIAVTLASQFGPKppLNLHKVG---LGAGSKD 235
gi 499179193 162 VAVGGGLVRGAHGLTPVPAPATTEILRG--FPVTGGPSGVELATPTGSALLVNMVREHRRF--FPPMEIQatgYGAGSMD 237
gi 499173317 146 INVGNGFVRTEHGLLPVPAPATAEILKG--LKIFFSDINEELTTPTGSAIIKYINPKLAKGa-FIIKEVS---YGAGDKD 219
gi 499182048 148 VRAGSGFVEFSHGKYPVPPPAVLEILKSsnLEVVMDGEG-ELLTPTGAAILSHYCKPLKPFp-IRVKEVS---YGAGKRE 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499173776 236 FPLANILRLWIGTEITPHnhplsseapfgqlETITVLETQLDDIQPQAVGYLLESLLHQ-GAIDVFTQAIAMKKSRPGIL 314
gi 499179193 238 PEFPNILRIVRGSGQVPH-------------DTVTLLETNVDHLSGEVLGNIFERLLEA-GALDVTLTPVIMKKNRPGQL 303
gi 499173317 220 LNLLNALRVFR-VEDIKR-------------EDIVLLETNVDDISAEILGYLYE-VLDG-KVRDLHFIPTYMKKNRPAYT 283
gi 499182048 223 TDVPNVLRLILG-ETAFH-------------DSIVVIETSVDDLSGEMIGYAMKKLLERdDVLDAVIIPAYGKKMRPASI 288
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499173776 315 LTVLCAPENQNHCLNLLFRETTSLGVRVR-QQQRYALEREWQTVVIPHGPIRiKVAYGYQAGKKIILNAHPEFADCAALA 393
gi 499179193 304 IRVICRENEYERILEHLFSETGTLGVRIFpQVHRGVLERRIMEAEVDIKGRR-TARFKVGLMGSRVVNARIEYEDARRIS 382
gi 499173317 284 IRAIVDRDIAEEVAKIIMRETGSLGVRIF-DIERITADREFKTIKL---FDE-SVRLKVGRVNDEIISQKPEFEDLKNIA 358
gi 499182048 289 LKVISPTHRSEEVAAEVMRLTGSLGIRIIpVHHRLISERMEEVVKVEISGKEfDVRVKRSYPGFRHL--KPEFDDIAVIA 366
                        410
                 ....*....|.
gi 499173776 394 KATGQPWQLIH 404
gi 499179193 383 LETGIPLRDVI 393
gi 499173317 359 KKYGIPLKDLY 369
gi 499182048 367 DELNIPPHVVY 377
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap