Conserved Protein Domain Family
eS8

?
TIGR00307: eS8 
ribosomal protein eS8
Archaeal and eukaryotic ribosomal protein S8. This model could easily have been split into two models, one for eukaryotic S8 and one for archaeal S8; eukaryotic forms invariably have in insert of about 80 residues that archaeal forms of S8 do not. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 129407
View PSSM: TIGR00307
Aligned: 4 rows
Threshold Bit Score: 165.018
Threshold Setting Gi: 407523
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 407523    1 MGISRdSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAK--RIHSVRTRGGNKKYRALRIETGNFSWASEGISKKTRI 78
gi 1710777   1 MSVWQ-GRSRRKPTGGLYRPARKKRKYEMGREPIETHVAEEafKIKKVRTRGGNLKVKVVRTGFANVLDPETGTCKKVKI 79
gi 3914931   1 -MIWQ-GRSRRKPSGGFYRKARKKRKYELGREQVETLIGER--KVKKIRVRGGNYKLKLFADKYANVYDPKQGKVVRVEI 76
gi 3914929   1 MAIWQ-GKSMKKPSGGRAKMNRGKRKYELGREPAETKIGDR--RVRLIRTRGGNTKVRLASDTRINVVDPETGKVEIAEI 77
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 407523   79 AGVVYHPSNNELVRTNTLTKAAIVQIDATpfrqwfeahygqtlgkkknvkeeetvaksknaerkwaaraasakiessves 158
gi 1710777  80 ITVRENKANIHYVRRNVITKGAIIETEIG--------------------------------------------------- 108
gi 3914931  77 ESVVENPAHVHYARRNVITKGAIIATSIG--------------------------------------------------- 105
gi 3914929  78 RNVVENTANPHFVRRNIITRGAVVETNLG--------------------------------------------------- 106
                      170       180
               ....*....|....*....|....*...
gi 407523  159 qfsagrlYACISSRPGQSGRCDGYILEG 186
gi 1710777 109 -------LAKVTSRPGQDGTVNAILIKE 129
gi 3914931 106 -------KARVTNRPSQEGVVNAVLIE- 125
gi 3914929 107 -------NVRVTSRPGQDGVINGVLIRE 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap