Conserved Protein Domain Family
aIF-2beta

?
TIGR00311: aIF-2beta 
translation initiation factor aIF-2, beta subunit, putative
The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129411
View PSSM: TIGR00311
Aligned: 3 rows
Threshold Bit Score: 222.417
Threshold Setting Gi: 3122238
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3122238   4 SYEELLERAFEKLADKDVVrRERFEIPRVSIQREGARTILKNFSQIAKTLNRSEDHLYKYIVKSLGTAGFIDNGRLVLQG 83
gi 2495796  11 DYKALLKRARSQIPDYVFQ-KDRFELPEIEILIEGNRTIIRNFRELAKAVNRDEEFFAKYLLKETGSAGNLEGGRLILQR 89
gi 3122237   3 DYEKLLERAIDQLPPEVFE-TKRFEVPKAYSVIQGNRTFIQNFREVADALNRDPQHLLKFLLRELGTAGNLEGGRAILQG 81
                       90       100       110       120       130
               ....*....|....*....|....*....|....*....|....*....|....
gi 3122238  84 KFTESELQKEVDDYVRLYVLCRECNSPDTEFIKEERVLMLRCLACGAKHPVRNI 137
gi 2495796  90 RISPELLKSRINDFLREYVICRECGKPDTKIIKEGRVHLLKCMACGAIRPIRMI 143
gi 3122237  82 KFTHFLINERIEDYVNKFVICHECNRPDTRIIREGRISLLKCEACGAKAPLKNV 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap