Conserved Protein Domain Family
cobQ

?
TIGR00313: cobQ 
cobyric acid synthase CobQ
[Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 129413
View PSSM: TIGR00313
Aligned: 4 rows
Threshold Bit Score: 767.418
Threshold Setting Gi: 6685342
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685342     4 LMVGGTTSSAGKSLLAAAFCRILARRGYDVAPFKAQNMSLNSFVTSKGKEIAIAQAYQAFAAGIEPDERMNPVLLKPKGN 83
gi 499176258  33 IMVVGTTSHAGKSFLTTGLCRLLRRRGDRVTPFKGQNMALNAFVTIDGGEMGHAQAVQAWAAGTVPRVAMNPILLKPQGD 112
gi 499178884  16 IMVQGTSSSAGKSVMVAALCRIFSRRGYRVAPFKSQNMSLNSFTTAENREIAVAQVLQAEAAGIEPSHHMNPVLLKPKED 95
gi 499172398   8 IMVVGTSSNSGKTTITAGLCRILANKGYKVAPFKSQNMSLNSRVAKEDGEIAIAQYTQSLACRVEPSVHFNPILLKPKGN 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685342    84 FVSQLVVMGEAVGDVDSRKYYGVKVEWLKRVVEEAYLSLAEEYDFVVIEGAGGMAEINLYERDLPNIHIARFARPDILIV 163
gi 499176258 113 MTSQVIMLGQAVGTTRAQEYYQNYFDRGWQAIANSLETLAQDFDVVVCEGAGSPAEINLKHRDLTNMRVATHLQAATILI 192
gi 499178884  96 FTSQVIVHGRPAGNMNFQDYQTEFRDTALEAIRESLEYLKSRYELIVIEGAGSPAEINMRDRDLANMEIAHLADADVILV 175
gi 499172398  88 FISQVIVHGRPYKDMNYNEYRKNK-DFFLKKIKESLEILDREYDYVIMEGAGSCCEINLLKDDIANLRIAELVNAKAILV 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685342   164 GDIDRGGVFASLYGTYALLPDDVKPLVKGFVINRLRGREDVLESGIRELERLTGIRVLGVLPYLDYN-FPSEDSLNIEEW 242
gi 499176258 193 ADIDRGGVFAHVVGTLQLLEPEERKLIKGIVINKFRGQRSLLDSGITWLEEYTGIPVLGVIPYGQNL-FSAEDSLDILER 271
gi 499178884 176 ADIDRGGVFASIAGTLMLLDERDRSRIKGVVINKFRGNIDILMPGIERIEEITGVPVLGVLPYDEGLkLPEEDSASLSQR 255
gi 499172398 167 ADIDRGGVFASIYGTIKLLPENWRKLIKGIIINKFRGNVEVLKEGIEKIEELTGIPVLGIVPYDENLvLPEEDSQVLQSM 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685342   243 GAEGT------VGIVRLPRVSNFTDFEPLREHA--R--FLSLNSSLNGCEVVIIPGSKDTIADLKALKSSKLGEEIVRKA 312
gi 499176258 272 SGRPSked-irIVVLRLPRIANFTDFEPLEAESgvYvdYLPLEKQLGNPDAVIIPGSKTTIADLQALQNSGMAQQIMDYA 350
gi 499178884 256 KYRGRgd--irVGVMRLPRISNFTDIDPLEYEEdvAvrLIETGDSLDDLDAIIIPGTRNTISDLIHLEENGFADEIRDLS 333
gi 499172398 247 RSFGNaksgveINVVRFSKISNFTDLDPLRYDA--FikFIDFDDDITG-DILIFPGTRSSTKEAYYLKQHNFDEKVLEFL 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685342   313 GEIP-VIGICGGYQIMCRELVDMG-VEHGRIRAKGLGLLDAVTEF-REyRKRTVQVEKRVNGNAvildriRGEKVWGYEI 389
gi 499176258 351 QAGGtVMGICGGYQMLGQTIADPEnIEGNVSNCQGLGLLPLTTVI-NQ-EKITRQCQTITHAPP------SGLTVTGYEI 422
gi 499178884 334 REIP-VFGICGGFQMLGKRILDDArQESSEGSVDGLGLLDCETHFtGE-GKIISQSQGRVLGNGifs-gmRGETVEGYEL 410
gi 499172398 324 KDGGiVIGICGGYQVLGKELIDKEkKESDVGDIEGLKIFDAKTYF-GN-DKVVKNSCGFLEIDN------KTFNVKGYEI 395
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685342   390 HKGITRA------SNPIFEDD---GCASE----------DGMCWGTYLHGLFWN-------ENVLR------ALGGYLGI 437
gi 499176258 423 HQGLSRRsehsqdFLPMFDQEe-lGMVNA----------QQNLWGCYLHGLFDNgawrrcwLNNLRqrrgldPLPTSIGN 491
gi 499178884 411 HEGTTVLg----dVKPLLRVDrgfGNTRSggfd---gavDGNVAGTYFHGIFHNfrfrryfTNLLRerkgiePLEYLDDN 483
gi 499172398 396 HEGFTYSk-----EKPLIKIErgfGNCGNgfdgsikkfgDGLAIGTYFHGIFENyefrnyiINLIRkr--kgLDEIYGDS 468
                        490       500
                 ....*....|....*....|....*
gi 6685342   438 KFRQKEDWADLIADEVEGRLDLGVL 462
gi 499176258 492 YQEQREGMLDSLADFVETHVNLEPI 516
gi 499178884 484 FSASRRFSIDRLAEIVEENMDLSII 508
gi 499172398 469 YKDSIEKSLNYFAEVVERSVNLKPL 493
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap