Conserved Protein Domain Family
cdhC

?
TIGR00316: cdhC 
CO dehydrogenase/CO-methylating acetyl-CoA synthase complex, beta subunit
Nomenclature follows the description for Methanosarcina thermophila. The CO-methylating acetyl-CoA synthase is considered the defining enzyme of the Wood-Ljungdahl pathway, used for acetate catabolism by sulfate reducing bacteria but for acetate biosynthesis by acetogenic bacteria such as oorella thermoacetica (f. Clostridium thermoaceticum). [Energy metabolism, Chemoautotrophy]
Statistics
?
PSSM-Id: 129416
View PSSM: TIGR00316
Aligned: 4 rows
Threshold Bit Score: 771.716
Threshold Setting Gi: 11497991
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499180346  21 EEAEFPFDISPMYEGERIRKGDMYVELGGPTQPGFELVMalPMDQVEDmKVTLIGPDLDEMEEGQAYPYAMIYYIAGEMV 100
gi 499172064   1 MFDDIPVSVGPMNEGERVRGPDMYVELAGPKSYGFELVK--VVNKAED-KVEIIGKDIDEMEEGSRNPFAIIVEVSGSNL 77
gi 499179778   1 MFEDIPVDVSPMHEGERIRSANMFVELAGPKSIGAELVQ--VKDEVEDgKVEVKGPEIDEMEQGQVYPFAINVEVAGSEL 78
gi 499172060 294 vEFDIPVSVGPMNEGERVRGPDMYVELAGPKSYGFELVK--VVNKAED-KVEIIGKDIDEMEEGSRNPFAIIVEVSGSNL 370
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499180346 101 ETDLEPVIERRNHDFQNYIEGYMHLNQRYDIWIRIGKNAIKKGLKsLIQIAKATMMLYKNELPFIEKIEAVYITDKDLVE 180
gi 499172064  78 EEDLEGVLERRIHEFLNYIEGVMHLNQRDQVWIRINKDSFNKGLR-LKHIGKVVQRLFKAEFPFIEKCDVTIITDPEKVK 156
gi 499179778  79 EEELESVIERRLHELCNYVKGFMHLNQRDQIWCRVSTEAKDAGFR-LEHLGKALSVLFREEFPIIESIAVTLMTDEAAVQ 157
gi 499172060 371 EEDLEGVLERRIHEFLNYIEGVMHLNQRDQVWIRINKNSFNKGLR-LKHIGEVVKQLFKEHFPIVEKCNVIIITDPDKVK 449
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499180346 181 KLLnELAMPIFEERDARVEALSDEDVDEFYSCTLCQSFAPTNVCIVSPDRPSLCGAITWFDGRAAAKVDPEGPNRAVPKG 260
gi 499172064 157 EEL-EKAREIYNKRDEKTKALHEEDVDVFYGCVMCQSFAPTHVCVITPDRPALCGGINYLDARAAAKIDPNGPIFEIPKG 235
gi 499179778 158 EFL-ETAREKYETRDSRARELSDEDVDVFYGCLMCQSFAPTHVCIVTPDRTALCGAINWFDCRAAYKMDPDGPIFEIEKG 236
gi 499172060 450 EEL-EKAKEIYKKRDEKTKSIREEDVDVFYGCVMCQSFAPTHVCIITPDRPSLCGSINYLDARAAAKIDPNGPIFEIPKG 528
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499180346 261 ELLDPIGGEYSGVNEFAKQESGGEYERIKLHSFFEYPHTSCGCFEVIGFYMPEVDGIGWVHRGYAEPAPNGLTFSTMAGQ 340
gi 499172064 236 ECLDEKLGIYSGVNEVVRERSQGTVEEVTLHSALEKPCTSCGCFEAIVFYIPEVDGFGIAHRGYKGETPMGIPFSTLAGQ 315
gi 499179778 237 EVLDPERGEYANVNAAVEENSQGTTDRVYLHSVFGYPHTSCGCFEAVAFYIPELDGIGIVNRDFRGETPLGIPFSAMAGQ 316
gi 499172060 529 ECLDEKLGIYTGVNEVVRERSQGSVEEMALHSALTNPCTSCGCFEAIVFYIPEVDGFGVAHRNFRGETPFGLPFSTLAGQ 608
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499180346 341 TGGGKQVVGFLGIGIAYFRSKKFIQADGGWYRTVWMPKELKERVAKYIPDDIRDKIATEEDAKTLDELREFLKKVDHPVV 420
gi 499172064 316 CSGGKQVPGFVGISISYMKSPKFLQGDGGWERVVWLPKELKERVKDAIPEELYDKIATEEDVKTTDELIKFLKEKGHPCA 395
gi 499179778 317 CSGGKQVEGFSGLSLEYMRSPKFLQADGGYHRVIWMPRELKESVLEFIPEDVRDKIATEEDATSIKDLRRFLRDNEHPVL 396
gi 499172060 609 CSGGKQVPGFVGISISYMKSPKFLQGDGGWERVVWLPKELKERVKDAIPEELYDKIATEEDVKTTDELIKFLKEKGHPIV 688
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499180346 421 KGVVRPVDGKKItngwveeeeeeaeevaeeaaaeaapaaqpaqAAQPMAMQPMPMQMPgfQLPALQMPAASAA-PAGVKL 499
gi 499172064 396 ERIGAEVEEEAI-------------------------------EEEEVEEEMEEVEGI--EVPTMTLPGTFAGlPPGIKI 442
gi 499179778 397 ERAAVEETEPEE-------------------------------EEVEEAYPEETPIPEgvPVMAAPEMTLPAA-G-GFRI 443
gi 499172060 689 K-KTEEEVVEEV-------------------------------EEEKEEVKATEEEKEgiEVGELITKLAKEG---GIQI 733
                        490
                 ....*....|....
gi 499180346 500 VIKDAKITIEKVII 513
gi 499172064 443 VLYNAVIKAEKIII 456
gi 499179778 444 VLKNAKIYAEKVII 457
gi 499172060 734 IMKNVKIVInlnvk 747
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap