1A79,1RLV


Conserved Protein Domain Family
endA

?
TIGR00324: endA 
Click on image for an interactive view with Cn3D
tRNA-intron lyase
The enzyme catalyses the endonucleolytic cleavage of pre tRNA at the 5' and 3' splice sites to release the intron and produces two half tRNA molecules bearing 5' hydroxyl and 2', 3'-cyclic phosphate termini. The genes are homologous in Eucarya and Archea. The two yeast genes have been functionally studied and are two subunits of a heterotetramer enzyme in yeast the other two subunits of which have no known homologs. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 129424
View PSSM: TIGR00324
Aligned: 7 rows
Threshold Bit Score: 166.107
Threshold Setting Gi: 40889677
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A79_A       1 KITGLLD----GDRVIVFDKNGIS--KLSAR-HYGNVEGNFLSLSLVEALYLINLG----WLEVKYKDNKPLSFEE-LYE 68
gi 3913580   9 KITGLLD----GDRVIVFDKNGIS--KLSAR-HYGNVEGNFLSLSLVEALYLINLG----WLEVKYKDNKPLSFEE-LYE 76
gi 3913568   2 RVEGQL-----GDEVVTIKATSIAr-RLHGKsHYGKMYEDRLQLSLIEAAYLMERG----KLKLMKDDDE-VSPEE-FIS 69
gi 3913569 148 EIAGIL-----SDEYVITKQTEIF-----SRyFYGSEKGDLVTLSLIESLYLLDLG----KLNLLNADRE----E--LVK 207
gi 134427  171 ESLRKFKlkqtEDVGIVAQQQDIS--ESNLRdEDNNLLDENGDLLPLESLELMPVEamflTFALPVLDISPACLAGkLFQ 248
gi 731301   94 EYQRKFK----KDEHIAKLKKIGRinDKTTAeELQRLDKSSNNDQLIESSLFIDIAntsmILRDIRSDSDSLSRDD-ISD 168
1RLV_A     148 EIAGVL-----SDEYVITKQTEIF-----SRyFYGSEKGDLVTLSLIESLYLLDLG----KLNLLNAD-----REE-LVK 207
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A79_A      69 YARN--VEERLCLKYLVYKDLRTRGYIVKTGLKYGADFRLYERGA-NIDKEHSVYLVKVFPEDSSFLLSELTGFVRVAHS 145
gi 3913580  77 YARN--VEERLCLKYLVYKDLRTRGYIVKTGLKYGADFRLYERGA-NIDKEHSVYLVKVFPEDSSFLLSELTGFVRVAHS 153
gi 3913568  70 LLG----ERGLYSKYLVYRDLRNRGYIVKTGFKYGAEFRLYERGG-APGRTHSAYLVRVISENDTIHALDFSSYVRVAHG 144
gi 3913569 208 RARE--VERNFDRRYEVYRNLKERGFVVKTGFKFGSEFRVYRKVEsVDDLPHSEYLVDIADSRE-IRLIDLARAVRLAQN 284
gi 134427  249 FDAKykDIHSFVRSYVIYHHYRSHGWCVRSGIKFGCDYLLYKRGP---PFQHAEFCVMGLDHDVSKDYTWYSSIARVVGG 325
gi 731301  169 LLFKqyRQAGKMQTYFLYKALRDQGYVLSPGGRFGGKFIAYPGDP-LRFHSHLTIQDAIDYHNEPIDLISMISGARLGTT 247
1RLV_A     208 RARE--VERNFDRRYEVYRNLKERGFVVKTGFKFGSEFRVYRKVEsVDDLPHSEYLVDIADSRE-IRLIDLARAVRLAQN 284
                      170       180       190       200
               ....*....|....*....|....*....|....*....|....*.
1A79_A     146 VRKKLLIAIVDAD-GDI---------------------VYYNMTYV 169
gi 3913580 154 VRKKLLIAIVDAD-GDI---------------------VYYNMTYV 177
gi 3913568 145 VNKKLLMAFLDDE-EDI---------------------TYYLVDWI 168
gi 3913569 285 VRKRMVFAYGKN---------------------------YLCFERV 303
gi 134427  326 AKKTFVLCYVERLiSEQeaialwksnnftklfnsfqvgEVLYKRWV 371
gi 731301  248 VKKLWVIGGVAEEtKET---------------------HFFSIEWA 272
1RLV_A     285 VRKRMVFAYGKN---------------------------YLCFERV 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap