Conserved Protein Domain Family
flhB

?
TIGR00328: flhB 
flagellar biosynthetic protein FlhB
FlhB and its functionally equivalent orthologs, from among a larger superfamily of proteins involved in type III protein export systems, are specifically involved in flagellar protein export. The seed members are restricted and the trusted cutoff is set high such that the proteins gathered by this model play roles specifically related to flagellar structures. Full-length homologs scoring below the trusted cutoff are involved in peptide export but not necessarily in the creation of flagella. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 129428
View PSSM: TIGR00328
Aligned: 16 rows
Threshold Bit Score: 412.814
Threshold Setting Gi: 16125329
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494574     7 DKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGG-VSLARRLSGMLSAGLHFDHSIINDPNLILGQIILLI 85
gi 3023763     5 EKTELPSAKKIQKAREEGNVPKSMEVVGVLGLLAGLISIFVFF-IWWVDGFSEMYRHVLK-DFSLDFSKESVQELFNQLA 82
gi 3435112     9 EKTEEPTQKRREQAREDGSIVTSKEVFVFATLAGG-LALLMMI-EGLLPALVRGWSGYLVIEPGADLERIAMVR-LGQAW 85
gi 17380369    9 SKTEAPSEKKISDATEKGNVPFSREVTAFASTLAIYIFVVFFLsDGAANMAEALKDIFEQPEAWRLDTATDAVALISHVV 88
gi 6225351    26 GRSEDPTETKLRKAREEGRVPKSQDLNGAFVMLFTSTSLFLLApFILRECIGVLRFFFTRATTASIQNT----GWFFVFV 101
gi 3023773    24 GRTELPTDQKKQKAREEGRVLKSTEINTAVSLLLLFALFFFMLsYFALDLIAVFKEQAIKLPEVMRMSVY---TMGFAYI 100
gi 500030996   8 SKTEEPTSKRLSDSRNKGQVVSSKEVPTALLMLAALAVFLVQG-NELWQALQRKMHFFLSGQISDDITPTGVSLIFNEII 86
gi 499201052  15 EKTEKATPKKRQDSRKKGQVAKSTDVNTAIILLCVFLFLWLFGgPLLGGTLEKLLIHTFESYLLMDVTEESVAELMFEIT 94
gi 446763726   8 ERTEEATPRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFG-EILAKGLMVAMQRLFELSREEIFDLGKLFDIIGGSL 86
gi 499268054 263 DKTEEATPKRKSEARKKGQVARSKEVPLAATLVAITFIISLGGqTFFNGLGVMMQTFFQSYIHSNLTEL-DLRRIIIFVI 341
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494574    86 REAMLALLPLISGVVLVALISPVML-GGLVFSGKSLQPKFSKLNP--LPGIKR-MFSAQTGAELLKAILKTILVGSVTGF 161
gi 3023763    83 KDTFLLLLPILIILVVVAFLSNVLQ-FGWLFAPKVIEPKFSKINP--INGVKN-LFSLKKLLDGSLITLKVFLAFFLGFF 158
gi 3435112    86 REVLIAGLVVSVPLLALVLLVQSAM-GGINFSTKALSFKASRINP--AAGLKR-MVSLKALVELAKAVAKVALLIGVAVL 161
gi 17380369   89 LKCAALVLPVFILLILFGVGSSIFQ-NLPRPVLDRIQPKWNRVSP--AAGFKR-IYGVQGLVEFGKSLFKIIVVSIVVVL 164
gi 6225351   102 RYFMKLALPISFVALVSGVAANIVQnKTVLFSVKSIRPQFKKISPdvIRFFKRsFFSTEGLFNLLKSLIKITAIFFVSYF 181
gi 3023773   101 RSIMGYVVLFFFASLAVNFFVNIIQ-VGFFITFKSLEPRWDKISFnfSRWAKNsFFSAGAFFNLFKSLLKVVIICLIYYF 179
gi 500030996  87 RAVVMDLAPFFALFLVVAIISGLIQ-HGWLITFEPLMPKFSKVNP--LQGLKR-LFSVRSLVEAFKSIVKIFVISFAVYL 162
gi 499201052  95 MEAAIVLLPIMAIALIAGVLASYIQ-VGPLFTTEPLKMKLSKIDP--IKGAKR-IFSVRALVEFLKSLLKIVLTGLAAFS 170
gi 446763726  87 VNLLLPLLMILSTLFIAALIGAAGV-GGISFSAEAAMPKLSKMNP--LSGLKR-MFGMQSWVELLKSILKVLLVSGVAFY 162
gi 499268054 342 LNAGKFIFMFGVPVMVVGIVANIAQ-TGWITTTEPIKPDLKKLNP--ISGFKR-IFSMTTIVNLLKDLVVVAVLSVVGYK 417
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494574   162 FLWHHWPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVKG 241
gi 3023763   159 IFSLFLGELNHAALLNLQGQLLWFKNKALWLISSLLFLFFVLAFIDLAIKRRQYTNSLKMTKQEVKDEYKQQEGNPEIKA 238
gi 3435112   162 VLRDELSPLDRLWTAAPGDAAAVLGAGLIRLVSALLIVLAVIGGLDLVWQAWSLTNSMKMSRQELKEESKESNGSPEVKG 241
gi 17380369  165 VLWNDYFATLDMMFSDPVTIFTTMISDLKQIIIVVLFATATLAIVDLFWTRHHWYTELRMTRQEVKDELKQSQGDPIVKS 244
gi 6225351   182 TIRNDLFMFVSLLGVSLTQSIFYITSLAGKVLLEVSLLLVVFSLPDYFFQRRQFIDSLKMSRQEVKEELKEQEGDPLVRS 261
gi 3023773   180 IIENNIGKISKLSEYTLQSGISIVLVIAYKICFFSVMFLAIVGVFDYLFQRSQYIESLKMTKEEVKQERKEMEGDPLLRS 259
gi 500030996 163 AMRNNIDQILGLADTTITEFTTLMFKDSLEILWRVTLAFLLIAVLDFIYQKFDYIKGLRMSKQEIKDEMKQMEGDPLLKG 242
gi 499201052 171 IVWFSLEDVMLLSQKSVENSFVTVAQLTALLGILIAILLLILSIPDYLYQRYDHEKQIRMSKQDVKDEHKNVEGDPKVKS 250
gi 446763726 163 LIEASQKDLFQLSLDVYPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKPEVKG 242
gi 499268054 418 FLMSNYGDIANLNNLMVQYIPQAYLSYVISIFRIVALIMIVIAGFDFVYNRYKYKKDMKMTKHEVKEEFKQAEGDPEIKG 497
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494574   242 RIRQMQRAAAR-----RRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRIREIGAENNVPTLEAPP 316
gi 3023763   239 KIRQMMLKNAT-----NKMMQEIPKANVVVTNPTHYAVALKFDEEH-PVPVVVAKGTDYLAIRIKGIAREHDIEIIENKT 312
gi 3435112   242 RMRRMQMEASRngarrRAALDDVPQATAIVTNPTHFAVALRYVPGETPAPVILAMGKGPMALDIIERGRKAGVGTVRIPL 321
gi 17380369  245 RLRSMQRDRAR-----KRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVALKIREIAEKNGIPVFEDPP 319
gi 6225351   262 YVRKQMQSLVR-----ES-ARNTTDADVVITNPTHFAVAVQYEPAYMTAPTVVAKGSDGTAYRIKRLAKEAGILIEENKP 335
gi 3023773   260 RIKERMRVILS-----TNLRVAIPQADVVITNPEHFAVAIKWDSETMLAPKVLAKGQDEIALTIKKIARENNVPLMENKL 334
gi 500030996 243 RIRQIQRELAQ-----SRMMQEVPKADVIITNPTHYACALQYTPGQMSAPKLVAKGKGLIAARIRELADENNIPRVENPP 317
gi 499201052 251 KRKQKQMEMAM-----QRMMQEVPKADVVITNPTHYAIALKYDQSKMDAPVIVAKGVDYVAFKIKSLAKQHNVVTVENKP 325
gi 446763726 243 RIRMLQREAAQ-----RRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMALKIREIAREYDIAIVPAPP 317
gi 499268054 498 KRRQRMREIVT-----RTMLSKVPDATVVITNPTHISVAIKYERGVDKAPTVVAKGADRTALRIKEIAKENNVPIMENKP 572
                        330       340       350
                 ....*....|....*....|....*....|....*..
gi 2494574   317 LARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWR 353
gi 3023763   313 LARELYRDVKLNAAIPEELFEAVAIVFAQVAKLEQER 349
gi 3435112   322 LARALYFTGDIGQEIPDGLDGAVAVVLAHVYRLDRGE 358
gi 17380369  320 LARSMFAQVSVDSVIPPVFYKAVAELIHRVYAAQPQQ 356
gi 6225351   336 LARALYTQVAIGREVPYEYFNALVLIFTKLDKFKTHa 372
gi 3023773   335 LARALYANVKVNEEIPREYWEIVSKILVRVYSITKKf 371
gi 500030996 318 LARTLYRDVELEQFIPPELFKAVAEVLAYVFSLKNRR 354
gi 499201052 326 LARALYDQADIGDQVPEQLFKAVAEVLAYVYRLKKKQ 362
gi 446763726 318 LARALYHTTELEQQIPDGLFVAVAQVLAFVFQLKQYR 354
gi 499268054 573 LARLIFKKVEVDEQIPAEMYQTVAEILALVYKLNKKQ 609
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap